Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074VVW6

Protein Details
Accession A0A074VVW6    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
93-117VFTPSKKPKTPKAKAKGKTKAVKSDHydrophilic
NLS Segment(s)
PositionSequence
98-113KKPKTPKAKAKGKTKA
Subcellular Location(s) nucl 15, cyto_nucl 13.833, cyto 8.5, cyto_mito 6.332
Family & Domain DBs
Amino Acid Sequences MATFTEREQKLMAAACQSFEGEPKLDIEKFSQLSGLTIGSARNAWAALKKKIFAQDASAKSPTTKASTTKSGKKRPPPVVMPSGDNGSDDEEVFTPSKKPKTPKAKAKGKTKAVKSDDDDKEEDEDEDYVKVKNEAADEDFEEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.19
4 0.2
5 0.17
6 0.16
7 0.17
8 0.13
9 0.13
10 0.14
11 0.18
12 0.17
13 0.18
14 0.19
15 0.22
16 0.22
17 0.21
18 0.21
19 0.17
20 0.17
21 0.17
22 0.14
23 0.08
24 0.08
25 0.08
26 0.07
27 0.07
28 0.07
29 0.07
30 0.07
31 0.07
32 0.12
33 0.17
34 0.22
35 0.24
36 0.25
37 0.27
38 0.32
39 0.34
40 0.28
41 0.29
42 0.32
43 0.33
44 0.37
45 0.35
46 0.29
47 0.28
48 0.28
49 0.24
50 0.19
51 0.18
52 0.17
53 0.19
54 0.28
55 0.33
56 0.4
57 0.47
58 0.53
59 0.58
60 0.64
61 0.7
62 0.68
63 0.7
64 0.66
65 0.63
66 0.6
67 0.55
68 0.48
69 0.39
70 0.33
71 0.27
72 0.22
73 0.17
74 0.12
75 0.11
76 0.1
77 0.09
78 0.08
79 0.1
80 0.1
81 0.1
82 0.12
83 0.16
84 0.22
85 0.26
86 0.31
87 0.4
88 0.51
89 0.6
90 0.68
91 0.73
92 0.78
93 0.82
94 0.87
95 0.87
96 0.86
97 0.84
98 0.8
99 0.8
100 0.74
101 0.72
102 0.66
103 0.67
104 0.61
105 0.58
106 0.53
107 0.44
108 0.42
109 0.36
110 0.31
111 0.22
112 0.18
113 0.14
114 0.14
115 0.13
116 0.11
117 0.12
118 0.12
119 0.12
120 0.14
121 0.15
122 0.17
123 0.19
124 0.21