Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074WV50

Protein Details
Accession A0A074WV50   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MVPKPKKKASKAALKKNRSNQTTHydrophilic
NLS Segment(s)
PositionSequence
4-18KPKKKASKAALKKNR
Subcellular Location(s) nucl 24, mito 2
Family & Domain DBs
Amino Acid Sequences MVPKPKKKASKAALKKNRSNQTTAKKVSEERQVPERDAPTTEASKSPSQTSNQLVDSAAPQKLQAIEQAKEQLEAVDDKIKRLEEMRKICENALTAVKELQKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.87
4 0.87
5 0.79
6 0.74
7 0.72
8 0.71
9 0.72
10 0.67
11 0.61
12 0.54
13 0.55
14 0.54
15 0.55
16 0.49
17 0.43
18 0.46
19 0.45
20 0.44
21 0.44
22 0.4
23 0.32
24 0.29
25 0.28
26 0.23
27 0.22
28 0.21
29 0.18
30 0.2
31 0.21
32 0.21
33 0.21
34 0.21
35 0.2
36 0.23
37 0.25
38 0.24
39 0.22
40 0.21
41 0.19
42 0.16
43 0.16
44 0.15
45 0.13
46 0.1
47 0.09
48 0.1
49 0.11
50 0.11
51 0.14
52 0.16
53 0.16
54 0.18
55 0.22
56 0.22
57 0.21
58 0.21
59 0.16
60 0.13
61 0.14
62 0.13
63 0.16
64 0.16
65 0.17
66 0.19
67 0.2
68 0.19
69 0.23
70 0.29
71 0.32
72 0.4
73 0.45
74 0.49
75 0.51
76 0.5
77 0.49
78 0.43
79 0.37
80 0.34
81 0.3
82 0.24
83 0.27