Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A074W009

Protein Details
Accession A0A074W009    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
12-31YCSRDCTKAHYKVHKKECAKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, cyto_mito 12.833, cyto 5, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR002893  Znf_MYND  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF01753  zf-MYND  
PROSITE View protein in PROSITE  
PS50865  ZF_MYND_2  
Amino Acid Sequences LKACTACKSVFYCSRDCTKAHYKVHKKECAKLAQEYSKTATFKPAVRTSAPKEGHKGGLQKWQFDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.44
3 0.41
4 0.42
5 0.43
6 0.49
7 0.53
8 0.6
9 0.63
10 0.7
11 0.79
12 0.81
13 0.74
14 0.71
15 0.7
16 0.66
17 0.59
18 0.53
19 0.49
20 0.46
21 0.44
22 0.39
23 0.35
24 0.32
25 0.3
26 0.26
27 0.26
28 0.23
29 0.25
30 0.31
31 0.32
32 0.31
33 0.34
34 0.4
35 0.4
36 0.47
37 0.48
38 0.44
39 0.45
40 0.46
41 0.48
42 0.46
43 0.46
44 0.4
45 0.46
46 0.46