Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074VK21

Protein Details
Accession A0A074VK21   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-25KSAKTKKTKDDKSAKKRRHDEQATABasic
NLS Segment(s)
PositionSequence
4-18KTKKTKDDKSAKKRR
Subcellular Location(s) nucl 19, cyto 5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036898  RNA_pol_Rpb7-like_N_sf  
IPR041178  RPA43_OB  
IPR045113  Rpb7-like  
Gene Ontology GO:0000428  C:DNA-directed RNA polymerase complex  
GO:0005730  C:nucleolus  
GO:0003677  F:DNA binding  
GO:0006352  P:DNA-templated transcription initiation  
Pfam View protein in Pfam  
PF17875  RPA43_OB  
Amino Acid Sequences KSAKTKKTKDDKSAKKRRHDEQATAATPAAAEETSETTIESLPKRPRIASPAADASTTSPFVKQTSSFYLPLSPIYHAFPVDGLCAEHISPLLLTYHPPLRGVILSYENPRLSNSPADAPSSRDGPDAAPTVLAKSIDEYAVSFVWLTVDFTLLRPTPGAVIEGFVSLQNESYLGLVCWNFFNAGVDRKRIPSNWKWVPNHNANAGTKSATDWMRGLRNKSDESSGHYVDENGKKIEGKIKFTVKDFESAPSTDRERGFLSIEGTLLSPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.9
3 0.89
4 0.87
5 0.87
6 0.84
7 0.8
8 0.79
9 0.79
10 0.7
11 0.63
12 0.54
13 0.43
14 0.35
15 0.27
16 0.19
17 0.09
18 0.07
19 0.07
20 0.1
21 0.11
22 0.11
23 0.11
24 0.1
25 0.12
26 0.16
27 0.17
28 0.22
29 0.28
30 0.34
31 0.37
32 0.38
33 0.41
34 0.44
35 0.48
36 0.44
37 0.43
38 0.43
39 0.41
40 0.39
41 0.35
42 0.3
43 0.26
44 0.24
45 0.19
46 0.14
47 0.14
48 0.15
49 0.17
50 0.16
51 0.17
52 0.23
53 0.27
54 0.27
55 0.27
56 0.28
57 0.26
58 0.27
59 0.25
60 0.18
61 0.16
62 0.17
63 0.17
64 0.15
65 0.14
66 0.12
67 0.11
68 0.1
69 0.09
70 0.08
71 0.07
72 0.07
73 0.07
74 0.07
75 0.06
76 0.06
77 0.05
78 0.06
79 0.06
80 0.06
81 0.07
82 0.09
83 0.13
84 0.13
85 0.14
86 0.13
87 0.14
88 0.14
89 0.14
90 0.13
91 0.13
92 0.15
93 0.17
94 0.2
95 0.19
96 0.19
97 0.19
98 0.19
99 0.17
100 0.17
101 0.16
102 0.16
103 0.16
104 0.19
105 0.18
106 0.2
107 0.19
108 0.19
109 0.18
110 0.15
111 0.14
112 0.12
113 0.14
114 0.13
115 0.11
116 0.1
117 0.09
118 0.09
119 0.1
120 0.09
121 0.07
122 0.06
123 0.07
124 0.06
125 0.06
126 0.06
127 0.06
128 0.06
129 0.07
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.04
136 0.05
137 0.05
138 0.06
139 0.09
140 0.08
141 0.09
142 0.08
143 0.08
144 0.08
145 0.08
146 0.09
147 0.06
148 0.07
149 0.07
150 0.07
151 0.07
152 0.06
153 0.07
154 0.06
155 0.06
156 0.05
157 0.05
158 0.05
159 0.05
160 0.05
161 0.05
162 0.06
163 0.06
164 0.07
165 0.07
166 0.07
167 0.07
168 0.07
169 0.09
170 0.1
171 0.17
172 0.18
173 0.21
174 0.22
175 0.25
176 0.28
177 0.29
178 0.34
179 0.34
180 0.43
181 0.49
182 0.56
183 0.57
184 0.62
185 0.67
186 0.67
187 0.64
188 0.58
189 0.55
190 0.47
191 0.46
192 0.39
193 0.32
194 0.24
195 0.21
196 0.22
197 0.17
198 0.18
199 0.17
200 0.2
201 0.27
202 0.31
203 0.34
204 0.36
205 0.4
206 0.41
207 0.42
208 0.43
209 0.35
210 0.39
211 0.41
212 0.36
213 0.32
214 0.3
215 0.29
216 0.32
217 0.36
218 0.32
219 0.27
220 0.27
221 0.27
222 0.29
223 0.35
224 0.32
225 0.33
226 0.38
227 0.44
228 0.46
229 0.48
230 0.53
231 0.46
232 0.46
233 0.41
234 0.37
235 0.33
236 0.31
237 0.3
238 0.28
239 0.31
240 0.32
241 0.32
242 0.3
243 0.29
244 0.3
245 0.31
246 0.28
247 0.26
248 0.21
249 0.21
250 0.18