Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7ER26

Protein Details
Accession A7ER26    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MNSSDNKKRKRAAQRVETDEIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25
Family & Domain DBs
KEGG ssl:SS1G_07779  -  
Amino Acid Sequences MNSSDNKKRKRAAQRVETDEIQMQSNAQSITSDMDLLLGEFGVERVSEFVADEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.81
3 0.79
4 0.7
5 0.61
6 0.53
7 0.43
8 0.33
9 0.24
10 0.17
11 0.12
12 0.13
13 0.11
14 0.08
15 0.07
16 0.06
17 0.08
18 0.08
19 0.07
20 0.05
21 0.06
22 0.06
23 0.06
24 0.05
25 0.04
26 0.03
27 0.03
28 0.04
29 0.04
30 0.04
31 0.04
32 0.05
33 0.06
34 0.06