Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A074VDZ0

Protein Details
Accession A0A074VDZ0   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
15-38ISKQRASKACNRCRVKKARCSGGYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MPPTKQTETQDLGDISKQRASKACNRCRVKKARCSGGYPCSRCKSSDALCIFGYPKKSKRKEFPEHYVRTLELQQFKLVAGLQTMYFMLLAANAWPGTRLPESQGNPFIHDILNRLGLLDPESDRSMEMEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.28
3 0.28
4 0.27
5 0.25
6 0.29
7 0.33
8 0.39
9 0.47
10 0.54
11 0.6
12 0.67
13 0.73
14 0.78
15 0.83
16 0.82
17 0.81
18 0.81
19 0.81
20 0.77
21 0.74
22 0.7
23 0.69
24 0.69
25 0.63
26 0.61
27 0.56
28 0.53
29 0.49
30 0.45
31 0.42
32 0.36
33 0.41
34 0.35
35 0.33
36 0.32
37 0.31
38 0.3
39 0.25
40 0.27
41 0.23
42 0.29
43 0.36
44 0.43
45 0.49
46 0.57
47 0.65
48 0.7
49 0.73
50 0.75
51 0.75
52 0.72
53 0.67
54 0.59
55 0.49
56 0.41
57 0.36
58 0.31
59 0.24
60 0.22
61 0.2
62 0.19
63 0.19
64 0.17
65 0.14
66 0.1
67 0.07
68 0.06
69 0.06
70 0.06
71 0.06
72 0.05
73 0.05
74 0.05
75 0.04
76 0.04
77 0.04
78 0.04
79 0.05
80 0.05
81 0.05
82 0.05
83 0.06
84 0.09
85 0.11
86 0.11
87 0.14
88 0.22
89 0.25
90 0.3
91 0.37
92 0.34
93 0.35
94 0.36
95 0.33
96 0.26
97 0.25
98 0.22
99 0.17
100 0.19
101 0.16
102 0.16
103 0.15
104 0.15
105 0.16
106 0.16
107 0.15
108 0.16
109 0.17
110 0.17
111 0.17