FuNGI

A0A074W4Q9

Protein Details

Accession

A0A074W4Q9

Localization Confidence

High

Confidence Score

18.9

NoLS Segment(s)

Position	Sequence	Protein Nature
365-388	VASSSKSRNRERSRDPSTNKRDIR	Hydrophilic
394-413	AAAARPKPSRQASRQTKPEE	Hydrophilic
430-469	AAEQREWSRERRSRERHNKNNEETVRRRPRQSQLAKELDV	Hydrophilic

NLS Segment(s)

Position	Sequence
396-400	AARPK
441-441	R
443-443	R

Subcellular Location(s)

extr 12, nucl 5, cyto 4, pero 2, mito 1, plas 1, E.R. 1, vacu 1

Family & Domain DBs

InterPro	View protein in InterPro IPR027537 Mmm1 IPR019411 MMM1_dom IPR031468 SMP_LBD
Gene Ontology	GO:0032865 C:ERMES complex GO:0008289 F:lipid binding GO:0006869 P:lipid transport GO:0007005 P:mitochondrion organization
Pfam	View protein in Pfam PF10296 MMM1
PROSITE	View protein in PROSITE PS51847 SMP
CDD	cd21671 SMP_Mmm1

Amino Acid Sequences

SSASFAQGFVLGQLTLALILIFLIKFFIFGEPPSADSRAATRAALRRQRTLSHASSLRRRSFSDLRLRKRSSAAVLAPRNISGGAVLTTDKILEKTYYNVDGHQPESLDWFNVLIAQTISQLRADALEGDAVLTSLTNALNGGHRPQFIDEIKVTEISLGEEFPIFSNCRVIPVDENGQPVKQMPAKKGTNRGGLGESRLQARMDVDLSDVVTLGIETKLVLNYPKPFSAVLPVALAVSVVRFSGTLSLSFTPSQQPDAPTTESESSSANPSSSPTTLTFTFLDDYRLDLSVHSLIGSRARLQDVPKIAQLVEQRIHAWFDERCVEPRFQQIVLPSLWPRKKNVRGGTDDLPEDAVVSDAEMDAVASSSKSRNRERSRDPSTNKRDIRTDRSPAAAARPKPSRQASRQTKPEELMTEEERLAAAGEELRAAEQREWSRERRSRERHNKNNEETVRRRPRQSQLAKELDVPS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.07
2	0.06
3	0.06
4	0.05
5	0.04
6	0.04
7	0.05
8	0.05
9	0.05
10	0.06
11	0.06
12	0.07
13	0.08
14	0.1
15	0.09
16	0.1
17	0.15
18	0.15
19	0.18
20	0.21
21	0.22
22	0.2
23	0.19
24	0.22
25	0.21
26	0.21
27	0.2
28	0.23
29	0.29
30	0.39
31	0.47
32	0.48
33	0.52
34	0.55
35	0.58
36	0.58
37	0.58
38	0.52
39	0.51
40	0.54
41	0.53
42	0.58
43	0.63
44	0.64
45	0.59
46	0.58
47	0.58
48	0.59
49	0.61
50	0.63
51	0.64
52	0.66
53	0.73
54	0.75
55	0.71
56	0.67
57	0.63
58	0.57
59	0.54
60	0.51
61	0.51
62	0.51
63	0.5
64	0.47
65	0.42
66	0.38
67	0.3
68	0.23
69	0.14
70	0.11
71	0.08
72	0.08
73	0.08
74	0.08
75	0.08
76	0.09
77	0.09
78	0.09
79	0.1
80	0.1
81	0.11
82	0.14
83	0.18
84	0.22
85	0.22
86	0.23
87	0.27
88	0.28
89	0.28
90	0.26
91	0.23
92	0.18
93	0.22
94	0.21
95	0.16
96	0.13
97	0.12
98	0.11
99	0.12
100	0.12
101	0.09
102	0.08
103	0.08
104	0.1
105	0.11
106	0.11
107	0.1
108	0.1
109	0.09
110	0.09
111	0.09
112	0.07
113	0.07
114	0.07
115	0.06
116	0.06
117	0.06
118	0.05
119	0.05
120	0.04
121	0.03
122	0.04
123	0.04
124	0.04
125	0.05
126	0.05
127	0.08
128	0.09
129	0.13
130	0.14
131	0.15
132	0.16
133	0.17
134	0.22
135	0.21
136	0.24
137	0.21
138	0.21
139	0.21
140	0.2
141	0.19
142	0.13
143	0.13
144	0.1
145	0.1
146	0.07
147	0.07
148	0.07
149	0.07
150	0.07
151	0.09
152	0.09
153	0.09
154	0.12
155	0.12
156	0.14
157	0.15
158	0.16
159	0.15
160	0.18
161	0.23
162	0.21
163	0.24
164	0.22
165	0.21
166	0.2
167	0.19
168	0.19
169	0.18
170	0.2
171	0.2
172	0.28
173	0.34
174	0.38
175	0.46
176	0.48
177	0.5
178	0.48
179	0.46
180	0.4
181	0.36
182	0.35
183	0.28
184	0.24
185	0.19
186	0.19
187	0.17
188	0.15
189	0.14
190	0.12
191	0.1
192	0.09
193	0.08
194	0.07
195	0.07
196	0.07
197	0.06
198	0.05
199	0.04
200	0.04
201	0.04
202	0.03
203	0.03
204	0.03
205	0.04
206	0.04
207	0.05
208	0.06
209	0.07
210	0.11
211	0.13
212	0.14
213	0.14
214	0.14
215	0.14
216	0.17
217	0.16
218	0.12
219	0.11
220	0.1
221	0.09
222	0.09
223	0.08
224	0.04
225	0.04
226	0.03
227	0.03
228	0.03
229	0.03
230	0.03
231	0.06
232	0.06
233	0.07
234	0.08
235	0.09
236	0.11
237	0.11
238	0.12
239	0.13
240	0.13
241	0.15
242	0.15
243	0.16
244	0.16
245	0.2
246	0.2
247	0.18
248	0.2
249	0.19
250	0.18
251	0.17
252	0.15
253	0.13
254	0.14
255	0.14
256	0.11
257	0.09
258	0.11
259	0.12
260	0.12
261	0.13
262	0.12
263	0.15
264	0.15
265	0.18
266	0.16
267	0.15
268	0.16
269	0.14
270	0.15
271	0.12
272	0.13
273	0.12
274	0.12
275	0.11
276	0.1
277	0.12
278	0.1
279	0.1
280	0.09
281	0.08
282	0.08
283	0.1
284	0.11
285	0.11
286	0.12
287	0.14
288	0.16
289	0.17
290	0.22
291	0.23
292	0.25
293	0.24
294	0.23
295	0.21
296	0.23
297	0.24
298	0.24
299	0.21
300	0.2
301	0.2
302	0.19
303	0.2
304	0.16
305	0.17
306	0.12
307	0.14
308	0.17
309	0.18
310	0.21
311	0.23
312	0.24
313	0.23
314	0.31
315	0.31
316	0.27
317	0.27
318	0.25
319	0.26
320	0.25
321	0.25
322	0.21
323	0.27
324	0.32
325	0.32
326	0.36
327	0.43
328	0.5
329	0.57
330	0.62
331	0.61
332	0.62
333	0.66
334	0.66
335	0.6
336	0.52
337	0.43
338	0.35
339	0.27
340	0.2
341	0.15
342	0.1
343	0.06
344	0.05
345	0.05
346	0.04
347	0.05
348	0.04
349	0.04
350	0.03
351	0.04
352	0.04
353	0.04
354	0.06
355	0.1
356	0.15
357	0.22
358	0.3
359	0.41
360	0.5
361	0.6
362	0.68
363	0.73
364	0.78
365	0.82
366	0.81
367	0.81
368	0.81
369	0.82
370	0.77
371	0.71
372	0.71
373	0.68
374	0.7
375	0.67
376	0.65
377	0.58
378	0.57
379	0.55
380	0.47
381	0.49
382	0.48
383	0.43
384	0.44
385	0.48
386	0.48
387	0.54
388	0.61
389	0.61
390	0.62
391	0.69
392	0.72
393	0.75
394	0.81
395	0.79
396	0.76
397	0.68
398	0.65
399	0.57
400	0.5
401	0.45
402	0.39
403	0.36
404	0.3
405	0.28
406	0.23
407	0.2
408	0.16
409	0.11
410	0.09
411	0.08
412	0.08
413	0.08
414	0.08
415	0.09
416	0.11
417	0.13
418	0.14
419	0.2
420	0.25
421	0.32
422	0.37
423	0.42
424	0.5
425	0.55
426	0.63
427	0.66
428	0.71
429	0.75
430	0.81
431	0.87
432	0.87
433	0.92
434	0.93
435	0.89
436	0.9
437	0.87
438	0.85
439	0.8
440	0.81
441	0.81
442	0.77
443	0.77
444	0.75
445	0.77
446	0.78
447	0.82
448	0.81
449	0.8
450	0.81
451	0.76

A0A074W4Q9

3D AlphaFold-predicted Structure Viewer