Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059F5J8

Protein Details
Accession A0A059F5J8   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-28GTLLKRVKRTEKEHIRNLEKNHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11, cyto_nucl 10, nucl 7, mito 5, pero 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004274  FCP1_dom  
IPR036412  HAD-like_sf  
IPR023214  HAD_sf  
Pfam View protein in Pfam  
PF03031  NIF  
Amino Acid Sequences MIVFDINGTLLKRVKRTEKEHIRNLEKNQFLPISHDSIYNYYFRKDLDKLSSFLDTNSVPYCFWTTMFEKNANICTELLKTVGFTKYLKIYNQDQCLIGNNKGKVKAEKWVKNLEIPSGELDVPLDRCVLIDDDLVKVYGNQNSFIVDEFNFELVDDGVEKIIDFIKQFIQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.48
3 0.55
4 0.63
5 0.7
6 0.76
7 0.8
8 0.83
9 0.81
10 0.79
11 0.79
12 0.76
13 0.68
14 0.59
15 0.55
16 0.47
17 0.38
18 0.37
19 0.33
20 0.28
21 0.25
22 0.26
23 0.23
24 0.23
25 0.25
26 0.23
27 0.21
28 0.18
29 0.18
30 0.17
31 0.21
32 0.2
33 0.24
34 0.28
35 0.3
36 0.3
37 0.31
38 0.33
39 0.28
40 0.26
41 0.23
42 0.15
43 0.15
44 0.15
45 0.13
46 0.11
47 0.12
48 0.14
49 0.12
50 0.12
51 0.14
52 0.15
53 0.2
54 0.23
55 0.23
56 0.22
57 0.23
58 0.26
59 0.22
60 0.21
61 0.16
62 0.14
63 0.14
64 0.13
65 0.12
66 0.08
67 0.08
68 0.09
69 0.1
70 0.1
71 0.09
72 0.1
73 0.14
74 0.16
75 0.16
76 0.18
77 0.24
78 0.28
79 0.31
80 0.3
81 0.27
82 0.25
83 0.29
84 0.28
85 0.26
86 0.25
87 0.25
88 0.26
89 0.28
90 0.3
91 0.29
92 0.27
93 0.31
94 0.36
95 0.41
96 0.43
97 0.47
98 0.46
99 0.47
100 0.47
101 0.41
102 0.32
103 0.26
104 0.24
105 0.19
106 0.17
107 0.13
108 0.13
109 0.12
110 0.11
111 0.11
112 0.09
113 0.07
114 0.07
115 0.09
116 0.09
117 0.09
118 0.09
119 0.1
120 0.1
121 0.11
122 0.11
123 0.1
124 0.09
125 0.12
126 0.14
127 0.14
128 0.14
129 0.14
130 0.15
131 0.16
132 0.16
133 0.14
134 0.11
135 0.13
136 0.13
137 0.13
138 0.12
139 0.11
140 0.11
141 0.1
142 0.1
143 0.08
144 0.08
145 0.07
146 0.07
147 0.07
148 0.07
149 0.09
150 0.1
151 0.09
152 0.11