Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059F2R9

Protein Details
Accession A0A059F2R9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
6-25FPVVKTRKTNRTFNRFQSDRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 9.5, mito 8, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVEPLFPVVKTRKTNRTFNRFQSDRFKRVGTSWRKPRGIDNRVRKKYSGAIQMPRVGYGSDKITRNLVDGFRKVQIRNMDDLLAIASQNRFYAGEIAHSVGAKKRIELFYKAAELDIKLYNGEARLERKDND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.72
3 0.76
4 0.77
5 0.77
6 0.8
7 0.72
8 0.71
9 0.72
10 0.7
11 0.65
12 0.6
13 0.53
14 0.44
15 0.46
16 0.51
17 0.5
18 0.52
19 0.57
20 0.63
21 0.65
22 0.64
23 0.68
24 0.69
25 0.69
26 0.68
27 0.69
28 0.71
29 0.75
30 0.77
31 0.68
32 0.6
33 0.57
34 0.54
35 0.52
36 0.47
37 0.44
38 0.45
39 0.48
40 0.45
41 0.39
42 0.33
43 0.23
44 0.18
45 0.14
46 0.15
47 0.15
48 0.16
49 0.16
50 0.18
51 0.18
52 0.18
53 0.19
54 0.18
55 0.17
56 0.17
57 0.18
58 0.2
59 0.23
60 0.22
61 0.24
62 0.28
63 0.27
64 0.28
65 0.27
66 0.24
67 0.21
68 0.21
69 0.17
70 0.11
71 0.08
72 0.07
73 0.06
74 0.06
75 0.06
76 0.07
77 0.07
78 0.07
79 0.1
80 0.09
81 0.11
82 0.12
83 0.13
84 0.13
85 0.13
86 0.13
87 0.14
88 0.19
89 0.17
90 0.18
91 0.23
92 0.28
93 0.31
94 0.35
95 0.35
96 0.34
97 0.37
98 0.35
99 0.3
100 0.26
101 0.23
102 0.22
103 0.2
104 0.16
105 0.13
106 0.14
107 0.15
108 0.15
109 0.17
110 0.18
111 0.21
112 0.27