Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059F120

Protein Details
Accession A0A059F120    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
73-93NVLAPEDKRKSKKNRIFKDKIHydrophilic
NLS Segment(s)
PositionSequence
80-92KRKSKKNRIFKDK
Subcellular Location(s) mito 12, nucl 11, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016193  Cytidine_deaminase-like  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0006139  P:nucleobase-containing compound metabolic process  
Amino Acid Sequences PIKFTNNNEFRIYISCEPCAMCYGILERLPIKIYYACKNNQFGCSNICNLDGGTLLFRKEAVYNLRKFFLKENVLAPEDKRKSKKNRIFKDKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.29
4 0.29
5 0.28
6 0.26
7 0.2
8 0.13
9 0.11
10 0.13
11 0.15
12 0.15
13 0.15
14 0.13
15 0.14
16 0.15
17 0.15
18 0.14
19 0.15
20 0.17
21 0.22
22 0.26
23 0.28
24 0.31
25 0.36
26 0.35
27 0.37
28 0.35
29 0.3
30 0.29
31 0.28
32 0.25
33 0.21
34 0.19
35 0.14
36 0.13
37 0.12
38 0.08
39 0.06
40 0.07
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.11
48 0.18
49 0.24
50 0.29
51 0.31
52 0.34
53 0.34
54 0.34
55 0.35
56 0.36
57 0.33
58 0.31
59 0.32
60 0.34
61 0.35
62 0.35
63 0.32
64 0.35
65 0.37
66 0.43
67 0.46
68 0.51
69 0.6
70 0.7
71 0.79
72 0.79
73 0.84