Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059F0A4

Protein Details
Accession A0A059F0A4    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
67-89KSDLCHLKEKKKVENKNYKECNLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 10, mito 9, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007644  RNA_pol_bsu_protrusion  
Gene Ontology GO:0000428  C:DNA-directed RNA polymerase complex  
GO:0003677  F:DNA binding  
GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF04563  RNA_pol_Rpb2_1  
Amino Acid Sequences VTNFVIHKPFLNEKEFLSLDRRLMPRECRNRMITYKGRAVITLNFVLDGELVHVEEKNCGYFPIMVKSDLCHLKEKKKVENKNYKECNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.36
3 0.32
4 0.29
5 0.26
6 0.24
7 0.3
8 0.3
9 0.27
10 0.31
11 0.38
12 0.44
13 0.52
14 0.55
15 0.54
16 0.57
17 0.59
18 0.58
19 0.58
20 0.54
21 0.49
22 0.48
23 0.45
24 0.41
25 0.36
26 0.34
27 0.28
28 0.24
29 0.2
30 0.14
31 0.11
32 0.11
33 0.11
34 0.09
35 0.07
36 0.04
37 0.04
38 0.04
39 0.04
40 0.05
41 0.05
42 0.07
43 0.07
44 0.08
45 0.08
46 0.08
47 0.09
48 0.11
49 0.12
50 0.18
51 0.19
52 0.19
53 0.19
54 0.2
55 0.26
56 0.28
57 0.29
58 0.31
59 0.35
60 0.42
61 0.5
62 0.55
63 0.59
64 0.64
65 0.72
66 0.74
67 0.81
68 0.81
69 0.85