Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EZ12

Protein Details
Accession A0A059EZ12    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
27-49IKMTHVKKVLKNKTKHRTSKVACHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 17, nucl 4, plas 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Amino Acid Sequences MASTKGAGKKDPASSGKSEEFDVKSAIKMTHVKKVLKNKTKHRTSKVACHAVAVAVYVLIKEIVIGAMEAADLENKKKVLPKHINLAIHKDTELAKIGHDILVRSGGVRNVIPPEMLKRKQVDKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.46
3 0.46
4 0.41
5 0.38
6 0.35
7 0.33
8 0.3
9 0.29
10 0.23
11 0.2
12 0.21
13 0.2
14 0.19
15 0.24
16 0.25
17 0.31
18 0.37
19 0.4
20 0.44
21 0.55
22 0.61
23 0.63
24 0.69
25 0.72
26 0.76
27 0.82
28 0.84
29 0.8
30 0.8
31 0.75
32 0.77
33 0.76
34 0.72
35 0.62
36 0.54
37 0.47
38 0.36
39 0.32
40 0.22
41 0.12
42 0.05
43 0.05
44 0.04
45 0.03
46 0.03
47 0.03
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.04
59 0.04
60 0.05
61 0.07
62 0.07
63 0.09
64 0.13
65 0.16
66 0.26
67 0.35
68 0.37
69 0.45
70 0.5
71 0.55
72 0.52
73 0.57
74 0.48
75 0.4
76 0.36
77 0.29
78 0.25
79 0.21
80 0.22
81 0.15
82 0.13
83 0.14
84 0.15
85 0.15
86 0.15
87 0.14
88 0.12
89 0.14
90 0.13
91 0.12
92 0.13
93 0.12
94 0.14
95 0.14
96 0.15
97 0.16
98 0.17
99 0.17
100 0.17
101 0.25
102 0.32
103 0.35
104 0.39
105 0.42