Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EXT6

Protein Details
Accession A0A059EXT6    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
41-60IHDIKKTFLNEKKKKKIKNSBasic
NLS Segment(s)
PositionSequence
52-60KKKKKIKNS
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007217  Per1-like  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0006506  P:GPI anchor biosynthetic process  
Pfam View protein in Pfam  
PF04080  Per1  
Amino Acid Sequences SILSSLVEISDIPPYKYIIDSHSIYHLISAPGIIYYYKYIIHDIKKTFLNEKKKKKIKNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.19
4 0.19
5 0.14
6 0.18
7 0.18
8 0.18
9 0.19
10 0.19
11 0.17
12 0.17
13 0.15
14 0.1
15 0.09
16 0.08
17 0.06
18 0.05
19 0.06
20 0.05
21 0.04
22 0.05
23 0.06
24 0.07
25 0.08
26 0.11
27 0.16
28 0.2
29 0.26
30 0.27
31 0.3
32 0.33
33 0.35
34 0.41
35 0.45
36 0.52
37 0.56
38 0.65
39 0.73
40 0.78