Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EWK6

Protein Details
Accession A0A059EWK6   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MDKERDKKRIKGERMKQTRDKRKELNKSSLHKNSBasic
NLS Segment(s)
PositionSequence
5-27RDKKRIKGERMKQTRDKRKELNK
Subcellular Location(s) nucl 21.5, mito_nucl 13.666, cyto_nucl 12.333
Family & Domain DBs
Amino Acid Sequences MDKERDKKRIKGERMKQTRDKRKELNKSSLHKNSTIKKDSQESNPYNVKDKILVKNFQAQIGEKLFVGPYEVIKVDINGNIVLIKLNNSFVWLNIKKNKTFSGNEDVRKSNNIFPAKVREKTNYLNGKFKINMTFMNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.89
3 0.89
4 0.89
5 0.89
6 0.87
7 0.86
8 0.85
9 0.85
10 0.87
11 0.85
12 0.84
13 0.82
14 0.79
15 0.81
16 0.79
17 0.72
18 0.66
19 0.65
20 0.63
21 0.64
22 0.62
23 0.55
24 0.51
25 0.54
26 0.53
27 0.53
28 0.54
29 0.48
30 0.49
31 0.52
32 0.49
33 0.48
34 0.44
35 0.37
36 0.32
37 0.35
38 0.37
39 0.36
40 0.37
41 0.34
42 0.41
43 0.41
44 0.37
45 0.33
46 0.26
47 0.24
48 0.23
49 0.22
50 0.13
51 0.13
52 0.11
53 0.1
54 0.1
55 0.07
56 0.05
57 0.06
58 0.07
59 0.07
60 0.07
61 0.08
62 0.08
63 0.08
64 0.09
65 0.08
66 0.08
67 0.07
68 0.07
69 0.06
70 0.06
71 0.06
72 0.06
73 0.07
74 0.07
75 0.1
76 0.1
77 0.1
78 0.19
79 0.2
80 0.25
81 0.32
82 0.36
83 0.36
84 0.39
85 0.42
86 0.39
87 0.4
88 0.4
89 0.42
90 0.45
91 0.48
92 0.49
93 0.48
94 0.44
95 0.45
96 0.43
97 0.38
98 0.39
99 0.38
100 0.35
101 0.36
102 0.45
103 0.48
104 0.5
105 0.49
106 0.46
107 0.48
108 0.52
109 0.58
110 0.58
111 0.55
112 0.59
113 0.56
114 0.58
115 0.54
116 0.51
117 0.47
118 0.4