Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059F0L7

Protein Details
Accession A0A059F0L7   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
95-133NGLKHLIRPRNRNKKNINGWLFYFIWRRRNKKIFLKPLCHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12.5, nucl 12, cyto 9, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR024445  Tnp_ISXO2-like  
Pfam View protein in Pfam  
PF12762  DDE_Tnp_IS1595  
Amino Acid Sequences SSGHLVEGVWVVGGIERTEEKKSFYIEVENRSSESLQNVIETFVLPGSIIYTDCFRAYGPACLNLQLEHFTVNHKENFVDPQTNVHTNCIEGLNNGLKHLIRPRNRNKKNINGWLFYFIWRRRNKKIFLKPLC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.1
4 0.12
5 0.16
6 0.17
7 0.2
8 0.21
9 0.24
10 0.24
11 0.24
12 0.31
13 0.31
14 0.36
15 0.37
16 0.35
17 0.34
18 0.33
19 0.32
20 0.24
21 0.21
22 0.17
23 0.13
24 0.13
25 0.12
26 0.11
27 0.11
28 0.1
29 0.08
30 0.06
31 0.06
32 0.05
33 0.04
34 0.04
35 0.05
36 0.05
37 0.05
38 0.07
39 0.07
40 0.08
41 0.08
42 0.07
43 0.1
44 0.1
45 0.14
46 0.14
47 0.16
48 0.16
49 0.17
50 0.17
51 0.15
52 0.14
53 0.12
54 0.11
55 0.09
56 0.09
57 0.09
58 0.12
59 0.14
60 0.14
61 0.13
62 0.13
63 0.13
64 0.17
65 0.17
66 0.17
67 0.15
68 0.18
69 0.21
70 0.24
71 0.24
72 0.22
73 0.2
74 0.18
75 0.19
76 0.16
77 0.13
78 0.09
79 0.12
80 0.16
81 0.16
82 0.16
83 0.16
84 0.15
85 0.17
86 0.26
87 0.32
88 0.34
89 0.44
90 0.55
91 0.65
92 0.72
93 0.8
94 0.8
95 0.82
96 0.85
97 0.85
98 0.8
99 0.73
100 0.67
101 0.63
102 0.55
103 0.49
104 0.47
105 0.42
106 0.45
107 0.5
108 0.55
109 0.6
110 0.68
111 0.73
112 0.75
113 0.82