Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EWQ5

Protein Details
Accession A0A059EWQ5    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
20-51MKAIQFNKKNRTENVKKKKELKKIEKETKVVTHydrophilic
NLS Segment(s)
PositionSequence
5-45RAANKKRILARKLHGMKAIQFNKKNRTENVKKKKELKKIEK
Subcellular Location(s) mito 12, nucl 10, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039411  NSA2_fam  
IPR022309  Ribosomal_S8e/biogenesis_NSA2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF01201  Ribosomal_S8e  
Amino Acid Sequences KKEVRAANKKRILARKLHGMKAIQFNKKNRTENVKKKKELKKIEKETKVVTPTSGEALPHFLLDRNIQTKSSDKEQNVMQVKKTKVNKYAVPIPRVQGIPESEAFKPITTGKKRACQWKRMVTKAVFVGENFTRKNPKYERFIRPTGLRFKHASVVNPQTQSTHRLEILGVKKNPHSDLYTNLGILTKGTIIEVNVGELGIVSSSGKIVWGKYAQITNNPENDGTINAILLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.7
3 0.69
4 0.68
5 0.64
6 0.58
7 0.58
8 0.6
9 0.62
10 0.61
11 0.61
12 0.64
13 0.68
14 0.74
15 0.73
16 0.7
17 0.72
18 0.74
19 0.77
20 0.81
21 0.82
22 0.81
23 0.85
24 0.88
25 0.88
26 0.88
27 0.88
28 0.87
29 0.88
30 0.91
31 0.88
32 0.82
33 0.75
34 0.71
35 0.64
36 0.53
37 0.43
38 0.34
39 0.28
40 0.27
41 0.23
42 0.17
43 0.13
44 0.16
45 0.16
46 0.14
47 0.13
48 0.12
49 0.12
50 0.14
51 0.19
52 0.18
53 0.19
54 0.19
55 0.21
56 0.24
57 0.26
58 0.31
59 0.33
60 0.3
61 0.32
62 0.33
63 0.4
64 0.43
65 0.41
66 0.38
67 0.38
68 0.4
69 0.45
70 0.5
71 0.48
72 0.47
73 0.51
74 0.5
75 0.48
76 0.56
77 0.54
78 0.5
79 0.45
80 0.39
81 0.38
82 0.35
83 0.29
84 0.23
85 0.18
86 0.18
87 0.17
88 0.19
89 0.15
90 0.17
91 0.17
92 0.14
93 0.14
94 0.15
95 0.22
96 0.22
97 0.29
98 0.31
99 0.38
100 0.42
101 0.51
102 0.54
103 0.53
104 0.58
105 0.61
106 0.64
107 0.6
108 0.63
109 0.53
110 0.51
111 0.44
112 0.38
113 0.29
114 0.22
115 0.22
116 0.17
117 0.2
118 0.17
119 0.17
120 0.22
121 0.22
122 0.3
123 0.33
124 0.37
125 0.42
126 0.51
127 0.58
128 0.58
129 0.61
130 0.58
131 0.56
132 0.56
133 0.57
134 0.51
135 0.46
136 0.41
137 0.4
138 0.42
139 0.39
140 0.36
141 0.33
142 0.37
143 0.38
144 0.37
145 0.35
146 0.31
147 0.31
148 0.33
149 0.3
150 0.26
151 0.21
152 0.2
153 0.21
154 0.26
155 0.3
156 0.34
157 0.32
158 0.32
159 0.34
160 0.37
161 0.39
162 0.34
163 0.32
164 0.25
165 0.28
166 0.32
167 0.3
168 0.27
169 0.25
170 0.23
171 0.18
172 0.17
173 0.13
174 0.07
175 0.06
176 0.07
177 0.07
178 0.07
179 0.1
180 0.09
181 0.09
182 0.09
183 0.09
184 0.08
185 0.07
186 0.07
187 0.04
188 0.05
189 0.04
190 0.04
191 0.05
192 0.05
193 0.07
194 0.08
195 0.08
196 0.13
197 0.15
198 0.17
199 0.21
200 0.27
201 0.27
202 0.34
203 0.41
204 0.41
205 0.43
206 0.43
207 0.39
208 0.35
209 0.34
210 0.27
211 0.23
212 0.18