Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059F2L8

Protein Details
Accession A0A059F2L8    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
37-75CCNKTMILRKRHDRKNKGYSYGCNNRNCRKNYFKKRFFLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MNIDLIKESAFFALIDTEESAIQLLQNQGLLIKDPVCCNKTMILRKRHDRKNKGYSYGCNNRNCRKNYFKKRFFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.08
4 0.09
5 0.08
6 0.08
7 0.08
8 0.06
9 0.06
10 0.07
11 0.07
12 0.06
13 0.06
14 0.06
15 0.07
16 0.07
17 0.08
18 0.07
19 0.08
20 0.09
21 0.1
22 0.14
23 0.15
24 0.15
25 0.15
26 0.19
27 0.24
28 0.32
29 0.39
30 0.44
31 0.5
32 0.6
33 0.69
34 0.75
35 0.78
36 0.79
37 0.81
38 0.82
39 0.82
40 0.8
41 0.76
42 0.72
43 0.71
44 0.72
45 0.69
46 0.67
47 0.68
48 0.69
49 0.73
50 0.71
51 0.7
52 0.71
53 0.75
54 0.78
55 0.82