Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059F6B4

Protein Details
Accession A0A059F6B4    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGRKKTLRSKMKRKSAKSGLESRBasic
NLS Segment(s)
PositionSequence
3-17RKKTLRSKMKRKSAK
Subcellular Location(s) nucl 14, mito_nucl 13.666, mito 11, cyto_nucl 9.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGRKKTLRSKMKRKSAKSGLESRFNCPECSNENVVQCKVDKKINRGTAYCTVCNASFTCKINNLSQPIDVYSNWIDNLNENN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.86
3 0.84
4 0.8
5 0.8
6 0.74
7 0.74
8 0.69
9 0.63
10 0.62
11 0.54
12 0.48
13 0.39
14 0.36
15 0.3
16 0.33
17 0.33
18 0.27
19 0.3
20 0.31
21 0.31
22 0.29
23 0.26
24 0.23
25 0.21
26 0.24
27 0.24
28 0.26
29 0.34
30 0.4
31 0.42
32 0.4
33 0.43
34 0.45
35 0.46
36 0.41
37 0.34
38 0.28
39 0.25
40 0.26
41 0.22
42 0.18
43 0.19
44 0.21
45 0.22
46 0.25
47 0.27
48 0.31
49 0.36
50 0.35
51 0.32
52 0.32
53 0.3
54 0.28
55 0.28
56 0.23
57 0.22
58 0.2
59 0.2
60 0.19
61 0.2
62 0.18