Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059F089

Protein Details
Accession A0A059F089    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
10-29RCNNCKKHSSLKLFPKKINKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 6, nucl 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005651  Trm112-like  
Pfam View protein in Pfam  
PF03966  Trm112p  
Amino Acid Sequences MKPFLLQILRCNNCKKHSSLKLFPKKINKTEYEIDKLKLMPSKELIEELNETFQKFEGYVVPHSEIDSINEESLSLIKLLFCNEVEEGELKCRECDEVYFINEGIPSFIKNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.55
3 0.55
4 0.61
5 0.65
6 0.67
7 0.72
8 0.77
9 0.79
10 0.8
11 0.8
12 0.78
13 0.76
14 0.73
15 0.66
16 0.61
17 0.62
18 0.61
19 0.57
20 0.51
21 0.45
22 0.4
23 0.36
24 0.33
25 0.29
26 0.24
27 0.2
28 0.2
29 0.21
30 0.19
31 0.2
32 0.17
33 0.15
34 0.16
35 0.14
36 0.15
37 0.13
38 0.13
39 0.12
40 0.12
41 0.1
42 0.09
43 0.09
44 0.08
45 0.09
46 0.11
47 0.12
48 0.14
49 0.13
50 0.13
51 0.14
52 0.12
53 0.11
54 0.14
55 0.13
56 0.11
57 0.11
58 0.11
59 0.1
60 0.1
61 0.09
62 0.05
63 0.05
64 0.05
65 0.06
66 0.07
67 0.09
68 0.09
69 0.1
70 0.1
71 0.1
72 0.11
73 0.12
74 0.12
75 0.15
76 0.17
77 0.16
78 0.16
79 0.16
80 0.17
81 0.17
82 0.17
83 0.19
84 0.21
85 0.23
86 0.24
87 0.24
88 0.23
89 0.22
90 0.21
91 0.17
92 0.14