Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EZP9

Protein Details
Accession A0A059EZP9   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
14-44VTKYDKLDKNEKKSLKKKCRKIYNNKGFFESHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, mito 9, cyto_nucl 9, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008936  Rho_GTPase_activation_prot  
IPR000198  RhoGAP_dom  
Gene Ontology GO:0005096  F:GTPase activator activity  
GO:0007165  P:signal transduction  
Pfam View protein in Pfam  
PF00620  RhoGAP  
PROSITE View protein in PROSITE  
PS50238  RHOGAP  
CDD cd00159  RhoGAP  
Amino Acid Sequences MFVIRSGNMSSYPVTKYDKLDKNEKKSLKKKCRKIYNNKGFFESIIDFLNPLNDCMSCEYKPIISSFIYKVINYLIKEGINTVGIFRLPSNNDLTNELVNYIKINKEVNLKDYDILTIANALKKYLREELNGLISDDLSITLEKNIKNKNKLKNIEYLAYALEEDKRELLIHLFTLFKKIDENSKINLMTLENIFICSAPSIFPKVVQKNLRDFIPLTRILIDIYNLDYEYVPSKLID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.32
4 0.41
5 0.47
6 0.49
7 0.59
8 0.64
9 0.67
10 0.74
11 0.77
12 0.77
13 0.78
14 0.84
15 0.84
16 0.86
17 0.87
18 0.88
19 0.91
20 0.91
21 0.94
22 0.94
23 0.93
24 0.92
25 0.84
26 0.78
27 0.67
28 0.56
29 0.49
30 0.39
31 0.29
32 0.21
33 0.19
34 0.15
35 0.14
36 0.18
37 0.14
38 0.13
39 0.12
40 0.11
41 0.12
42 0.16
43 0.2
44 0.16
45 0.18
46 0.18
47 0.18
48 0.19
49 0.19
50 0.17
51 0.14
52 0.17
53 0.17
54 0.21
55 0.21
56 0.2
57 0.2
58 0.2
59 0.23
60 0.2
61 0.21
62 0.17
63 0.16
64 0.16
65 0.16
66 0.14
67 0.11
68 0.1
69 0.09
70 0.08
71 0.08
72 0.08
73 0.08
74 0.11
75 0.11
76 0.13
77 0.16
78 0.18
79 0.19
80 0.2
81 0.21
82 0.18
83 0.17
84 0.15
85 0.12
86 0.1
87 0.09
88 0.09
89 0.08
90 0.09
91 0.1
92 0.11
93 0.18
94 0.18
95 0.21
96 0.23
97 0.22
98 0.22
99 0.21
100 0.19
101 0.12
102 0.12
103 0.08
104 0.07
105 0.07
106 0.09
107 0.08
108 0.08
109 0.09
110 0.1
111 0.13
112 0.16
113 0.17
114 0.16
115 0.18
116 0.2
117 0.22
118 0.21
119 0.19
120 0.14
121 0.12
122 0.11
123 0.09
124 0.07
125 0.04
126 0.04
127 0.04
128 0.06
129 0.1
130 0.11
131 0.17
132 0.25
133 0.3
134 0.39
135 0.47
136 0.54
137 0.61
138 0.66
139 0.63
140 0.63
141 0.61
142 0.54
143 0.47
144 0.39
145 0.29
146 0.23
147 0.2
148 0.13
149 0.12
150 0.1
151 0.1
152 0.09
153 0.09
154 0.09
155 0.1
156 0.1
157 0.09
158 0.09
159 0.1
160 0.11
161 0.11
162 0.15
163 0.15
164 0.14
165 0.15
166 0.16
167 0.23
168 0.28
169 0.31
170 0.29
171 0.34
172 0.34
173 0.32
174 0.32
175 0.24
176 0.2
177 0.17
178 0.17
179 0.12
180 0.12
181 0.12
182 0.11
183 0.11
184 0.09
185 0.09
186 0.08
187 0.1
188 0.13
189 0.13
190 0.18
191 0.26
192 0.31
193 0.39
194 0.45
195 0.48
196 0.52
197 0.56
198 0.53
199 0.47
200 0.43
201 0.4
202 0.4
203 0.36
204 0.29
205 0.27
206 0.26
207 0.24
208 0.23
209 0.19
210 0.14
211 0.14
212 0.14
213 0.13
214 0.13
215 0.13
216 0.13
217 0.15
218 0.14