Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EVX5

Protein Details
Accession A0A059EVX5    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
86-127LKHLIKPRNRTKKNINGWLFYFTWRRQNKKKIWKGFLKALKVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR024445  Tnp_ISXO2-like  
Pfam View protein in Pfam  
PF12762  DDE_Tnp_IS1595  
Amino Acid Sequences VGGIERTPYKKCFYIEVADRSAETIQNILNTFVWPGSIIYTDCFKSYVPSCRNLNFSHLTVNHKENFVDPITLVHTNTIEGLNNGLKHLIKPRNRTKKNINGWLFYFTWRRQNKKKIWKGFLKALKVIKYLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.46
3 0.48
4 0.46
5 0.42
6 0.4
7 0.36
8 0.33
9 0.25
10 0.18
11 0.13
12 0.11
13 0.13
14 0.14
15 0.14
16 0.13
17 0.12
18 0.12
19 0.11
20 0.1
21 0.08
22 0.08
23 0.07
24 0.08
25 0.08
26 0.09
27 0.11
28 0.12
29 0.11
30 0.12
31 0.11
32 0.13
33 0.17
34 0.25
35 0.25
36 0.3
37 0.33
38 0.34
39 0.38
40 0.35
41 0.36
42 0.3
43 0.28
44 0.27
45 0.26
46 0.28
47 0.27
48 0.3
49 0.26
50 0.24
51 0.23
52 0.19
53 0.19
54 0.16
55 0.13
56 0.1
57 0.09
58 0.11
59 0.12
60 0.11
61 0.09
62 0.09
63 0.08
64 0.09
65 0.09
66 0.06
67 0.06
68 0.08
69 0.09
70 0.09
71 0.09
72 0.1
73 0.1
74 0.11
75 0.2
76 0.26
77 0.31
78 0.4
79 0.51
80 0.61
81 0.66
82 0.72
83 0.74
84 0.76
85 0.79
86 0.8
87 0.74
88 0.66
89 0.64
90 0.6
91 0.51
92 0.45
93 0.41
94 0.33
95 0.39
96 0.42
97 0.49
98 0.54
99 0.64
100 0.71
101 0.76
102 0.84
103 0.85
104 0.87
105 0.88
106 0.86
107 0.86
108 0.83
109 0.78
110 0.74
111 0.7
112 0.65