Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EXU4

Protein Details
Accession A0A059EXU4    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MKFHPKEKRFYCPKKSCNRRVSIYEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MKFHPKEKRFYCPKKSCNRRVSIYEKTFFESSKIKINKLLLLCYMYLVCDCSVNGIKMSLVCSSKTISRWLEYLRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.91
3 0.9
4 0.89
5 0.86
6 0.8
7 0.77
8 0.75
9 0.74
10 0.7
11 0.63
12 0.55
13 0.52
14 0.46
15 0.39
16 0.34
17 0.27
18 0.22
19 0.28
20 0.28
21 0.25
22 0.27
23 0.28
24 0.3
25 0.27
26 0.26
27 0.18
28 0.17
29 0.17
30 0.14
31 0.12
32 0.08
33 0.08
34 0.08
35 0.07
36 0.06
37 0.06
38 0.09
39 0.12
40 0.12
41 0.12
42 0.12
43 0.12
44 0.12
45 0.14
46 0.14
47 0.14
48 0.14
49 0.15
50 0.17
51 0.2
52 0.22
53 0.27
54 0.26
55 0.27
56 0.3