Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EWU3

Protein Details
Accession A0A059EWU3    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MFYLWKRRARKYNCIRKKTKEVKCFKFGEHydrophilic
33-52YSNKCIKKKVNKIKIYHSKKHydrophilic
81-102GLLKCSKNTKIHKSKIREYKLIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13.166, nucl 13, mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MFYLWKRRARKYNCIRKKTKEVKCFKFGEIGHYSNKCIKKKVNKIKIYHSKKLDERIIRINNRPYRAIFDTGATGNIICSGLLKCSKNTKIHKSKIREYKLINGTNIKQWVGKSCI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.87
3 0.86
4 0.89
5 0.89
6 0.88
7 0.86
8 0.86
9 0.84
10 0.83
11 0.78
12 0.67
13 0.64
14 0.54
15 0.51
16 0.47
17 0.41
18 0.39
19 0.37
20 0.38
21 0.37
22 0.44
23 0.39
24 0.38
25 0.44
26 0.49
27 0.59
28 0.68
29 0.71
30 0.72
31 0.73
32 0.79
33 0.82
34 0.79
35 0.76
36 0.69
37 0.65
38 0.6
39 0.63
40 0.59
41 0.51
42 0.45
43 0.46
44 0.49
45 0.46
46 0.48
47 0.5
48 0.47
49 0.47
50 0.45
51 0.38
52 0.36
53 0.36
54 0.34
55 0.26
56 0.22
57 0.22
58 0.2
59 0.2
60 0.14
61 0.11
62 0.08
63 0.08
64 0.07
65 0.05
66 0.06
67 0.06
68 0.09
69 0.14
70 0.15
71 0.17
72 0.26
73 0.32
74 0.4
75 0.48
76 0.56
77 0.62
78 0.71
79 0.77
80 0.77
81 0.8
82 0.82
83 0.81
84 0.78
85 0.71
86 0.72
87 0.72
88 0.68
89 0.63
90 0.58
91 0.54
92 0.53
93 0.52
94 0.43
95 0.36
96 0.33