Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059F2R3

Protein Details
Accession A0A059F2R3    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
66-95FKEQPKIEEKKKTEKKNKAPEKKNVQGNLSHydrophilic
NLS Segment(s)
PositionSequence
73-88EEKKKTEKKNKAPEKK
Subcellular Location(s) cyto 13.5, cyto_nucl 12.5, nucl 10.5
Family & Domain DBs
Amino Acid Sequences MHKFYTFINKEVNLENELIKDTSLKPIYLNSKKENDVTQLYLSTNKDNGILCGVTNGKLDSLIDIFKEQPKIEEKKKTEKKNKAPEKKNVQGNLSSFFIKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.2
4 0.2
5 0.18
6 0.14
7 0.14
8 0.13
9 0.2
10 0.2
11 0.19
12 0.18
13 0.23
14 0.33
15 0.38
16 0.42
17 0.4
18 0.43
19 0.45
20 0.46
21 0.43
22 0.37
23 0.32
24 0.29
25 0.25
26 0.21
27 0.2
28 0.21
29 0.2
30 0.17
31 0.15
32 0.14
33 0.14
34 0.13
35 0.13
36 0.11
37 0.1
38 0.08
39 0.09
40 0.09
41 0.09
42 0.09
43 0.09
44 0.07
45 0.07
46 0.07
47 0.06
48 0.07
49 0.06
50 0.06
51 0.07
52 0.09
53 0.12
54 0.15
55 0.14
56 0.16
57 0.23
58 0.3
59 0.36
60 0.44
61 0.46
62 0.55
63 0.65
64 0.73
65 0.77
66 0.8
67 0.84
68 0.86
69 0.92
70 0.91
71 0.91
72 0.91
73 0.9
74 0.88
75 0.86
76 0.81
77 0.74
78 0.69
79 0.62
80 0.56
81 0.48