Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059F2Q2

Protein Details
Accession A0A059F2Q2   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
202-249NDTFKNKIIKKPKEIIKKNKIKNKKRGGIKIKERKKLIFDKKIEREEABasic
NLS Segment(s)
PositionSequence
208-253KIIKKPKEIIKKNKIKNKKRGGIKIKERKKLIFDKKIEREEAKRKK
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002687  Nop_dom  
IPR036070  Nop_dom_sf  
Pfam View protein in Pfam  
PF01798  Nop  
Amino Acid Sequences MDDLLIKFKALSAWKMHKLLRMEEIVPKLPEFEIYPTVKISNIAKEYTFIRHKEETKENEDMNYFNYYSNKDLAIFEERIKASSVNCDLLIKEEMVKLNVNDEFIAIESIQLMLFTKIKEEVKNNCKNLTKSIGNEKAALLLCELGSLKRLVEIPSKNLKGIGYSSNMLLEQPSYLFNSKIPLKKIVKEVSWSAKQDYFNFNDTFKNKIIKKPKEIIKKNKIKNKKRGGIKIKERKKLIFDKKIEREEAKRKKEELFSSVSSDNEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.48
3 0.5
4 0.51
5 0.52
6 0.51
7 0.48
8 0.44
9 0.39
10 0.4
11 0.42
12 0.41
13 0.38
14 0.34
15 0.3
16 0.26
17 0.25
18 0.21
19 0.2
20 0.22
21 0.23
22 0.24
23 0.24
24 0.24
25 0.23
26 0.24
27 0.23
28 0.23
29 0.24
30 0.24
31 0.23
32 0.25
33 0.26
34 0.31
35 0.35
36 0.29
37 0.32
38 0.37
39 0.41
40 0.46
41 0.53
42 0.52
43 0.52
44 0.55
45 0.5
46 0.46
47 0.43
48 0.36
49 0.29
50 0.26
51 0.2
52 0.17
53 0.18
54 0.18
55 0.19
56 0.2
57 0.18
58 0.16
59 0.16
60 0.17
61 0.2
62 0.2
63 0.19
64 0.23
65 0.23
66 0.22
67 0.23
68 0.21
69 0.16
70 0.2
71 0.21
72 0.17
73 0.17
74 0.17
75 0.16
76 0.18
77 0.18
78 0.13
79 0.12
80 0.12
81 0.13
82 0.13
83 0.14
84 0.11
85 0.13
86 0.13
87 0.13
88 0.11
89 0.1
90 0.09
91 0.08
92 0.09
93 0.06
94 0.05
95 0.04
96 0.05
97 0.04
98 0.04
99 0.05
100 0.05
101 0.06
102 0.06
103 0.07
104 0.1
105 0.12
106 0.15
107 0.19
108 0.27
109 0.35
110 0.43
111 0.44
112 0.46
113 0.48
114 0.47
115 0.46
116 0.43
117 0.36
118 0.3
119 0.38
120 0.38
121 0.35
122 0.35
123 0.31
124 0.28
125 0.26
126 0.23
127 0.15
128 0.09
129 0.08
130 0.08
131 0.08
132 0.05
133 0.06
134 0.06
135 0.06
136 0.06
137 0.08
138 0.09
139 0.16
140 0.17
141 0.22
142 0.3
143 0.31
144 0.29
145 0.29
146 0.27
147 0.22
148 0.23
149 0.2
150 0.14
151 0.14
152 0.14
153 0.14
154 0.14
155 0.12
156 0.1
157 0.08
158 0.06
159 0.06
160 0.07
161 0.08
162 0.09
163 0.1
164 0.1
165 0.15
166 0.21
167 0.25
168 0.26
169 0.33
170 0.36
171 0.4
172 0.47
173 0.47
174 0.43
175 0.42
176 0.45
177 0.44
178 0.46
179 0.43
180 0.39
181 0.38
182 0.39
183 0.39
184 0.39
185 0.35
186 0.34
187 0.33
188 0.31
189 0.33
190 0.32
191 0.32
192 0.3
193 0.35
194 0.33
195 0.41
196 0.51
197 0.53
198 0.6
199 0.65
200 0.71
201 0.74
202 0.81
203 0.83
204 0.84
205 0.86
206 0.87
207 0.88
208 0.9
209 0.89
210 0.9
211 0.9
212 0.88
213 0.87
214 0.89
215 0.89
216 0.89
217 0.89
218 0.9
219 0.88
220 0.88
221 0.83
222 0.77
223 0.76
224 0.76
225 0.76
226 0.75
227 0.74
228 0.76
229 0.8
230 0.81
231 0.79
232 0.73
233 0.72
234 0.73
235 0.75
236 0.74
237 0.72
238 0.68
239 0.69
240 0.72
241 0.68
242 0.63
243 0.59
244 0.52
245 0.5
246 0.49