Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059F0I3

Protein Details
Accession A0A059F0I3    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-35LIAIFKLRKKYTKKMIRKFNTNNFIIHydrophilic
NLS Segment(s)
Subcellular Location(s) E.R. 7, mito 6, nucl 5.5, cyto_nucl 4.5, cyto 2.5, pero 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008676  MRG  
IPR038217  MRG_C_sf  
IPR026541  MRG_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0006325  P:chromatin organization  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF05712  MRG  
PROSITE View protein in PROSITE  
PS51640  MRG  
Amino Acid Sequences MLILIFSLILIAIFKLRKKYTKKMIRKFNTNNFIITKLEDEWFEGRVVESLPEQKSSNEVSLYRVYVFRLFTELSQPVKEYSLMHSTPENIRKFKLTSFRGENRGPHFPSILKETIIQDKQKTKENFFLKLPAKYPISRILNDFKKFIQLNKGGITEEELDEIVLGFCHLFETTFFQFLLYSNELDYVNQFLSEMVNIQKTSVFGAEYLLRLIFLLHKKLLNRIECSDTADLTFDFSIYLLDFMALNYERYFSKDNYLKEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.23
3 0.28
4 0.37
5 0.45
6 0.55
7 0.62
8 0.7
9 0.79
10 0.81
11 0.87
12 0.87
13 0.9
14 0.9
15 0.89
16 0.87
17 0.78
18 0.72
19 0.63
20 0.56
21 0.46
22 0.37
23 0.29
24 0.22
25 0.22
26 0.18
27 0.19
28 0.18
29 0.18
30 0.16
31 0.14
32 0.12
33 0.12
34 0.12
35 0.1
36 0.11
37 0.16
38 0.17
39 0.19
40 0.2
41 0.19
42 0.22
43 0.23
44 0.23
45 0.2
46 0.19
47 0.21
48 0.22
49 0.23
50 0.21
51 0.19
52 0.19
53 0.19
54 0.19
55 0.16
56 0.16
57 0.15
58 0.15
59 0.19
60 0.21
61 0.2
62 0.2
63 0.2
64 0.18
65 0.19
66 0.19
67 0.15
68 0.15
69 0.19
70 0.19
71 0.19
72 0.19
73 0.21
74 0.26
75 0.33
76 0.33
77 0.28
78 0.29
79 0.31
80 0.32
81 0.34
82 0.37
83 0.33
84 0.35
85 0.41
86 0.46
87 0.49
88 0.5
89 0.5
90 0.45
91 0.49
92 0.44
93 0.37
94 0.33
95 0.28
96 0.27
97 0.28
98 0.24
99 0.18
100 0.18
101 0.19
102 0.24
103 0.26
104 0.26
105 0.25
106 0.3
107 0.31
108 0.38
109 0.39
110 0.35
111 0.4
112 0.41
113 0.41
114 0.36
115 0.42
116 0.36
117 0.35
118 0.34
119 0.29
120 0.29
121 0.26
122 0.27
123 0.28
124 0.28
125 0.27
126 0.29
127 0.33
128 0.37
129 0.38
130 0.37
131 0.29
132 0.32
133 0.32
134 0.31
135 0.31
136 0.27
137 0.27
138 0.28
139 0.29
140 0.23
141 0.22
142 0.23
143 0.16
144 0.13
145 0.11
146 0.09
147 0.08
148 0.07
149 0.08
150 0.05
151 0.04
152 0.03
153 0.03
154 0.03
155 0.04
156 0.04
157 0.04
158 0.04
159 0.1
160 0.11
161 0.13
162 0.13
163 0.12
164 0.13
165 0.13
166 0.18
167 0.14
168 0.13
169 0.12
170 0.14
171 0.14
172 0.14
173 0.14
174 0.1
175 0.09
176 0.08
177 0.08
178 0.07
179 0.07
180 0.07
181 0.08
182 0.08
183 0.11
184 0.11
185 0.11
186 0.12
187 0.12
188 0.13
189 0.12
190 0.11
191 0.08
192 0.1
193 0.12
194 0.11
195 0.12
196 0.1
197 0.09
198 0.09
199 0.09
200 0.13
201 0.15
202 0.19
203 0.21
204 0.24
205 0.25
206 0.33
207 0.4
208 0.4
209 0.41
210 0.41
211 0.44
212 0.42
213 0.46
214 0.4
215 0.33
216 0.28
217 0.25
218 0.2
219 0.17
220 0.16
221 0.11
222 0.09
223 0.09
224 0.09
225 0.08
226 0.08
227 0.06
228 0.06
229 0.06
230 0.06
231 0.11
232 0.11
233 0.12
234 0.12
235 0.14
236 0.14
237 0.19
238 0.23
239 0.19
240 0.29
241 0.34