Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059F3J1

Protein Details
Accession A0A059F3J1   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
26-50TIDAYKCKFTKKQRKQFQDKGIYTYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR015257  Maf1  
IPR038564  Maf1_sf  
Gene Ontology GO:0016480  P:negative regulation of transcription by RNA polymerase III  
Pfam View protein in Pfam  
PF09174  Maf1  
Amino Acid Sequences MRLIQAPQLLRTNKILEQYTSDVNFTIDAYKCKFTKKQRKQFQDKGIYTYIKLALNISFPDYKFDDLELIDIKKSDINQVKDTLSFRLNNLLSNYESGVENALLTVFDSVMDIKNSSIYLIDKRLEMFCLVGWFTCFFLYNKKRKRLLLCVVTASKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.36
3 0.3
4 0.34
5 0.34
6 0.35
7 0.32
8 0.3
9 0.24
10 0.22
11 0.21
12 0.16
13 0.17
14 0.14
15 0.16
16 0.19
17 0.24
18 0.25
19 0.3
20 0.38
21 0.44
22 0.54
23 0.62
24 0.7
25 0.75
26 0.85
27 0.9
28 0.92
29 0.91
30 0.9
31 0.8
32 0.75
33 0.69
34 0.59
35 0.49
36 0.42
37 0.34
38 0.24
39 0.22
40 0.18
41 0.14
42 0.14
43 0.14
44 0.14
45 0.14
46 0.13
47 0.16
48 0.16
49 0.16
50 0.15
51 0.15
52 0.13
53 0.11
54 0.12
55 0.11
56 0.1
57 0.09
58 0.09
59 0.09
60 0.09
61 0.09
62 0.15
63 0.19
64 0.22
65 0.23
66 0.25
67 0.26
68 0.27
69 0.27
70 0.23
71 0.19
72 0.16
73 0.15
74 0.19
75 0.19
76 0.19
77 0.19
78 0.19
79 0.17
80 0.17
81 0.17
82 0.12
83 0.12
84 0.1
85 0.09
86 0.07
87 0.06
88 0.06
89 0.05
90 0.04
91 0.04
92 0.04
93 0.03
94 0.03
95 0.04
96 0.05
97 0.06
98 0.07
99 0.07
100 0.07
101 0.08
102 0.08
103 0.08
104 0.09
105 0.09
106 0.12
107 0.15
108 0.16
109 0.16
110 0.18
111 0.18
112 0.18
113 0.17
114 0.14
115 0.11
116 0.13
117 0.13
118 0.11
119 0.12
120 0.12
121 0.12
122 0.12
123 0.13
124 0.11
125 0.22
126 0.31
127 0.4
128 0.49
129 0.58
130 0.64
131 0.7
132 0.77
133 0.77
134 0.78
135 0.76
136 0.71
137 0.69