Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7ES38

Protein Details
Accession A7ES38    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
129-153AVPKRPTVVNGKKRRTLPRYPCSNVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 7, cyto_nucl 6.5, nucl 4, extr 3
Family & Domain DBs
KEGG ssl:SS1G_08143  -  
Amino Acid Sequences MFIRGSRNLSLHPVEVAFPILHPPCRRRDRMSSPANQGNPAAYFIYDIAVHFFFLIPRKLVFVTAAIRNHAELKELVCVSPPLGARFRGNSFGIRYGEAVESFGSNLDKGQHPNSTIQKWDCQFGSANAVPKRPTVVNGKKRRTLPRYPCSNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.2
4 0.14
5 0.11
6 0.17
7 0.18
8 0.23
9 0.27
10 0.3
11 0.38
12 0.47
13 0.53
14 0.53
15 0.61
16 0.65
17 0.7
18 0.75
19 0.72
20 0.72
21 0.73
22 0.67
23 0.58
24 0.49
25 0.41
26 0.33
27 0.27
28 0.19
29 0.12
30 0.11
31 0.09
32 0.1
33 0.09
34 0.08
35 0.09
36 0.08
37 0.08
38 0.08
39 0.08
40 0.08
41 0.11
42 0.12
43 0.11
44 0.11
45 0.12
46 0.12
47 0.13
48 0.12
49 0.11
50 0.13
51 0.16
52 0.17
53 0.16
54 0.16
55 0.16
56 0.18
57 0.16
58 0.14
59 0.1
60 0.1
61 0.12
62 0.12
63 0.11
64 0.09
65 0.1
66 0.08
67 0.11
68 0.11
69 0.11
70 0.12
71 0.14
72 0.14
73 0.17
74 0.18
75 0.19
76 0.19
77 0.19
78 0.19
79 0.22
80 0.22
81 0.2
82 0.19
83 0.17
84 0.17
85 0.14
86 0.13
87 0.09
88 0.08
89 0.08
90 0.08
91 0.07
92 0.06
93 0.07
94 0.09
95 0.11
96 0.14
97 0.17
98 0.18
99 0.2
100 0.27
101 0.32
102 0.32
103 0.36
104 0.35
105 0.39
106 0.38
107 0.4
108 0.33
109 0.29
110 0.28
111 0.24
112 0.29
113 0.25
114 0.32
115 0.31
116 0.34
117 0.33
118 0.32
119 0.35
120 0.28
121 0.3
122 0.33
123 0.41
124 0.49
125 0.59
126 0.66
127 0.69
128 0.76
129 0.82
130 0.79
131 0.8
132 0.8
133 0.8