Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059F1E9

Protein Details
Accession A0A059F1E9    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
13-32NFKKEIKKTREKAKALNKRWBasic
NLS Segment(s)
PositionSequence
16-30KEIKKTREKAKALNK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001005  SANT/Myb  
IPR039467  TFIIIB_B''_Myb  
Pfam View protein in Pfam  
PF15963  Myb_DNA-bind_7  
CDD cd00167  SANT  
Amino Acid Sequences MDKKLSFFLENANFKKEIKKTREKAKALNKRWSSKETDLFYEALKVCGLEFTLINQIFTGRTRKQIKNKYLKEEKINKDIIEEILKSRKSFDREMFEKLKLKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.46
3 0.46
4 0.47
5 0.48
6 0.56
7 0.6
8 0.7
9 0.79
10 0.76
11 0.78
12 0.79
13 0.81
14 0.77
15 0.8
16 0.76
17 0.73
18 0.73
19 0.67
20 0.64
21 0.59
22 0.59
23 0.52
24 0.47
25 0.42
26 0.38
27 0.34
28 0.31
29 0.24
30 0.18
31 0.15
32 0.11
33 0.09
34 0.09
35 0.09
36 0.05
37 0.05
38 0.05
39 0.11
40 0.11
41 0.11
42 0.11
43 0.11
44 0.11
45 0.13
46 0.18
47 0.13
48 0.22
49 0.3
50 0.37
51 0.47
52 0.56
53 0.65
54 0.7
55 0.75
56 0.76
57 0.78
58 0.77
59 0.77
60 0.77
61 0.73
62 0.69
63 0.66
64 0.56
65 0.48
66 0.44
67 0.37
68 0.3
69 0.25
70 0.22
71 0.26
72 0.28
73 0.27
74 0.3
75 0.34
76 0.35
77 0.41
78 0.45
79 0.47
80 0.49
81 0.56
82 0.56
83 0.56