Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059F041

Protein Details
Accession A0A059F041    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MSIKNPDKKIPPQKLKLPRKKRHINITLFLHydrophilic
NLS Segment(s)
PositionSequence
8-22KKIPPQKLKLPRKKR
Subcellular Location(s) mito 13, nucl 11, cyto 3
Family & Domain DBs
Amino Acid Sequences MSIKNPDKKIPPQKLKLPRKKRHINITLFLYGKTLRVAYKRCDYSPLEHNFELREISEKTGVPKSTTFEIIKKNNKLNTIKRIPGSMCRLLLKRCGNFGSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.89
4 0.89
5 0.88
6 0.89
7 0.91
8 0.9
9 0.9
10 0.88
11 0.83
12 0.78
13 0.74
14 0.68
15 0.58
16 0.49
17 0.4
18 0.31
19 0.25
20 0.2
21 0.15
22 0.12
23 0.16
24 0.2
25 0.23
26 0.31
27 0.33
28 0.32
29 0.36
30 0.36
31 0.35
32 0.4
33 0.41
34 0.38
35 0.35
36 0.35
37 0.3
38 0.29
39 0.24
40 0.16
41 0.14
42 0.1
43 0.11
44 0.13
45 0.13
46 0.16
47 0.2
48 0.2
49 0.19
50 0.19
51 0.21
52 0.21
53 0.25
54 0.24
55 0.23
56 0.3
57 0.37
58 0.45
59 0.48
60 0.52
61 0.51
62 0.58
63 0.62
64 0.62
65 0.64
66 0.63
67 0.62
68 0.57
69 0.58
70 0.53
71 0.53
72 0.52
73 0.47
74 0.43
75 0.43
76 0.45
77 0.44
78 0.5
79 0.5
80 0.46
81 0.46