Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EX28

Protein Details
Accession A0A059EX28   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MKYNKNVSSSRRKQRKAHFTANQAERRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR041988  KOW_RPL26/RPL24  
IPR014722  Rib_L2_dom2  
IPR005756  Ribosomal_L26/L24P_euk/arc  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF16906  Ribosomal_L26  
CDD cd06089  KOW_RPL26  
Amino Acid Sequences MKYNKNVSSSRRKQRKAHFTANQAERRIRMSSTLSKELRAKYGFRSFPVRTQDKVTVMAGKFKKLQGVVTAVRRKEYKVYVDSCENTLSNGKKQPVGIDASNLRIDEFCMENGRQGLLEKKAEKRKVIAVEEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.86
4 0.86
5 0.83
6 0.8
7 0.82
8 0.82
9 0.78
10 0.7
11 0.64
12 0.55
13 0.5
14 0.44
15 0.34
16 0.29
17 0.28
18 0.32
19 0.36
20 0.43
21 0.41
22 0.42
23 0.46
24 0.45
25 0.45
26 0.39
27 0.34
28 0.32
29 0.4
30 0.38
31 0.36
32 0.41
33 0.37
34 0.41
35 0.47
36 0.44
37 0.37
38 0.4
39 0.41
40 0.35
41 0.36
42 0.3
43 0.27
44 0.24
45 0.31
46 0.26
47 0.25
48 0.25
49 0.23
50 0.25
51 0.2
52 0.2
53 0.14
54 0.19
55 0.19
56 0.25
57 0.3
58 0.27
59 0.29
60 0.29
61 0.28
62 0.28
63 0.28
64 0.26
65 0.27
66 0.29
67 0.3
68 0.34
69 0.34
70 0.31
71 0.29
72 0.24
73 0.2
74 0.22
75 0.21
76 0.21
77 0.25
78 0.26
79 0.26
80 0.27
81 0.27
82 0.25
83 0.28
84 0.23
85 0.23
86 0.23
87 0.24
88 0.25
89 0.23
90 0.21
91 0.16
92 0.16
93 0.14
94 0.14
95 0.12
96 0.15
97 0.15
98 0.17
99 0.18
100 0.18
101 0.16
102 0.16
103 0.2
104 0.21
105 0.28
106 0.3
107 0.39
108 0.49
109 0.54
110 0.56
111 0.55
112 0.58
113 0.59