Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EWH8

Protein Details
Accession A0A059EWH8    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
76-96KQIFKYFYKKCKGKNNSSENIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, cyto_nucl 10.5, nucl 6.5, pero 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR045116  Clp1/Grc3  
IPR032324  Clp1_N  
IPR038239  Clp1_N_sf  
IPR032319  CLP1_P  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0051731  F:polynucleotide 5'-hydroxyl-kinase activity  
GO:0006396  P:RNA processing  
Pfam View protein in Pfam  
PF16573  CLP1_N  
PF16575  CLP1_P  
Amino Acid Sequences MQITELKPLHELRFEGQEVKIFITEGIVEFLGQELLNERWYVFKNTKGYFYSTTGAKFKLDGKIDLVYASNYTNLKQIFKYFYKKCKGKNNSSENILILGRGRTTFCTTIINLFLRNRQEVILTELAPDTGAVCFSGVLGISLIDKVIEYNKGVDLTNSLLYFYGSNKIEDHFDKYKLIIQEIFNKLKNNKNIKDKIKNKIYNFFIGPNNLEIIELIKKENNINEIIVLGDERLYHQVEGNKIFIPNNGYVKCNKARIREYFYGRSEDLTPYNLFNKNFPCITWSSEVSAPTSALPLGAERRLVIDNVEEIETENNYVYGILEEKGIKPCLGFVVPLEGNRLLAPKNKLMRDVVLFKGDLKYYEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.31
4 0.32
5 0.29
6 0.29
7 0.27
8 0.2
9 0.18
10 0.16
11 0.15
12 0.11
13 0.12
14 0.1
15 0.09
16 0.09
17 0.09
18 0.09
19 0.08
20 0.07
21 0.08
22 0.09
23 0.11
24 0.11
25 0.11
26 0.15
27 0.18
28 0.25
29 0.25
30 0.31
31 0.37
32 0.39
33 0.45
34 0.43
35 0.45
36 0.42
37 0.43
38 0.4
39 0.34
40 0.37
41 0.34
42 0.33
43 0.28
44 0.26
45 0.27
46 0.31
47 0.31
48 0.28
49 0.28
50 0.29
51 0.28
52 0.27
53 0.23
54 0.16
55 0.14
56 0.13
57 0.14
58 0.13
59 0.13
60 0.17
61 0.18
62 0.2
63 0.2
64 0.24
65 0.27
66 0.33
67 0.41
68 0.44
69 0.52
70 0.6
71 0.65
72 0.69
73 0.73
74 0.77
75 0.78
76 0.81
77 0.81
78 0.76
79 0.74
80 0.68
81 0.57
82 0.5
83 0.39
84 0.29
85 0.21
86 0.15
87 0.12
88 0.11
89 0.12
90 0.12
91 0.17
92 0.17
93 0.17
94 0.19
95 0.19
96 0.21
97 0.23
98 0.22
99 0.2
100 0.21
101 0.24
102 0.24
103 0.25
104 0.23
105 0.2
106 0.2
107 0.18
108 0.21
109 0.19
110 0.16
111 0.16
112 0.15
113 0.14
114 0.13
115 0.12
116 0.07
117 0.05
118 0.05
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.03
125 0.04
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.03
132 0.03
133 0.04
134 0.05
135 0.06
136 0.06
137 0.08
138 0.08
139 0.1
140 0.1
141 0.1
142 0.09
143 0.1
144 0.11
145 0.1
146 0.1
147 0.08
148 0.09
149 0.09
150 0.09
151 0.13
152 0.11
153 0.12
154 0.13
155 0.13
156 0.16
157 0.16
158 0.22
159 0.19
160 0.2
161 0.2
162 0.2
163 0.23
164 0.21
165 0.21
166 0.18
167 0.16
168 0.23
169 0.28
170 0.3
171 0.28
172 0.31
173 0.33
174 0.36
175 0.43
176 0.43
177 0.45
178 0.52
179 0.58
180 0.64
181 0.71
182 0.72
183 0.73
184 0.75
185 0.75
186 0.68
187 0.68
188 0.62
189 0.55
190 0.49
191 0.43
192 0.35
193 0.29
194 0.27
195 0.2
196 0.18
197 0.14
198 0.13
199 0.09
200 0.09
201 0.09
202 0.09
203 0.09
204 0.1
205 0.11
206 0.12
207 0.14
208 0.14
209 0.13
210 0.13
211 0.12
212 0.11
213 0.1
214 0.09
215 0.07
216 0.05
217 0.04
218 0.04
219 0.05
220 0.07
221 0.08
222 0.09
223 0.11
224 0.14
225 0.17
226 0.19
227 0.2
228 0.19
229 0.19
230 0.19
231 0.18
232 0.19
233 0.19
234 0.23
235 0.23
236 0.23
237 0.24
238 0.3
239 0.33
240 0.37
241 0.38
242 0.4
243 0.46
244 0.51
245 0.58
246 0.59
247 0.62
248 0.61
249 0.59
250 0.56
251 0.49
252 0.44
253 0.38
254 0.33
255 0.27
256 0.23
257 0.22
258 0.19
259 0.24
260 0.26
261 0.25
262 0.26
263 0.28
264 0.29
265 0.29
266 0.27
267 0.26
268 0.23
269 0.27
270 0.27
271 0.25
272 0.24
273 0.26
274 0.27
275 0.25
276 0.23
277 0.19
278 0.15
279 0.15
280 0.11
281 0.09
282 0.08
283 0.09
284 0.12
285 0.12
286 0.13
287 0.12
288 0.15
289 0.16
290 0.16
291 0.14
292 0.13
293 0.13
294 0.14
295 0.14
296 0.12
297 0.11
298 0.13
299 0.12
300 0.12
301 0.1
302 0.08
303 0.08
304 0.08
305 0.08
306 0.07
307 0.08
308 0.08
309 0.1
310 0.12
311 0.14
312 0.19
313 0.21
314 0.2
315 0.18
316 0.19
317 0.21
318 0.2
319 0.18
320 0.14
321 0.2
322 0.21
323 0.22
324 0.25
325 0.21
326 0.21
327 0.22
328 0.23
329 0.17
330 0.23
331 0.28
332 0.32
333 0.4
334 0.42
335 0.45
336 0.46
337 0.49
338 0.49
339 0.49
340 0.44
341 0.4
342 0.38
343 0.36
344 0.37
345 0.33