Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059F496

Protein Details
Accession A0A059F496   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
46-69ASSIRRWLKFAKPKKKISNLIYDIHydrophilic
NLS Segment(s)
PositionSequence
59-59K
Subcellular Location(s) nucl 16, cyto_nucl 10.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR008936  Rho_GTPase_activation_prot  
IPR000198  RhoGAP_dom  
Gene Ontology GO:0005096  F:GTPase activator activity  
GO:0007165  P:signal transduction  
Pfam View protein in Pfam  
PF00620  RhoGAP  
PROSITE View protein in PROSITE  
PS50238  RHOGAP  
CDD cd00159  RhoGAP  
Amino Acid Sequences MLTSSTGKIKCLKIIKYDRLFQNEKDSLRSYCLRKYQDETPLNTLASSIRRWLKFAKPKKKISNLIYDIINHLKKEGIHTEGIFRLPSNFAATNKLTNHIINNESIDLSCFDVLTIANAFKKYIREELDGLIPEEVAYTLEKNIKNNNPLKNIEYFPFTLEEDKRKLLIEVFSLFKEIDKYSKVNRMNINNILLIVPPTIFPKAVQRNIKEFLPFVDILKEIYRLDYENVPNIFIDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.64
3 0.65
4 0.7
5 0.69
6 0.7
7 0.7
8 0.61
9 0.62
10 0.58
11 0.53
12 0.49
13 0.46
14 0.39
15 0.41
16 0.45
17 0.39
18 0.4
19 0.47
20 0.47
21 0.48
22 0.51
23 0.53
24 0.57
25 0.59
26 0.56
27 0.53
28 0.51
29 0.46
30 0.41
31 0.34
32 0.26
33 0.23
34 0.19
35 0.2
36 0.25
37 0.25
38 0.28
39 0.33
40 0.4
41 0.48
42 0.58
43 0.63
44 0.65
45 0.74
46 0.82
47 0.86
48 0.85
49 0.8
50 0.8
51 0.73
52 0.67
53 0.58
54 0.49
55 0.42
56 0.39
57 0.36
58 0.25
59 0.21
60 0.19
61 0.18
62 0.22
63 0.22
64 0.18
65 0.18
66 0.19
67 0.21
68 0.21
69 0.21
70 0.17
71 0.14
72 0.13
73 0.12
74 0.12
75 0.13
76 0.14
77 0.13
78 0.18
79 0.19
80 0.22
81 0.21
82 0.23
83 0.2
84 0.19
85 0.2
86 0.18
87 0.18
88 0.14
89 0.15
90 0.13
91 0.12
92 0.11
93 0.1
94 0.08
95 0.08
96 0.07
97 0.06
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.06
105 0.07
106 0.07
107 0.08
108 0.1
109 0.11
110 0.15
111 0.18
112 0.19
113 0.2
114 0.21
115 0.22
116 0.21
117 0.2
118 0.15
119 0.12
120 0.09
121 0.08
122 0.07
123 0.05
124 0.05
125 0.04
126 0.06
127 0.12
128 0.13
129 0.15
130 0.21
131 0.25
132 0.32
133 0.38
134 0.43
135 0.43
136 0.44
137 0.45
138 0.42
139 0.4
140 0.33
141 0.3
142 0.25
143 0.2
144 0.2
145 0.18
146 0.19
147 0.2
148 0.23
149 0.23
150 0.24
151 0.24
152 0.22
153 0.22
154 0.2
155 0.19
156 0.17
157 0.17
158 0.18
159 0.17
160 0.18
161 0.17
162 0.15
163 0.16
164 0.14
165 0.14
166 0.16
167 0.19
168 0.23
169 0.32
170 0.35
171 0.39
172 0.45
173 0.49
174 0.52
175 0.53
176 0.51
177 0.42
178 0.39
179 0.33
180 0.26
181 0.2
182 0.14
183 0.1
184 0.08
185 0.1
186 0.11
187 0.11
188 0.11
189 0.21
190 0.29
191 0.38
192 0.45
193 0.47
194 0.53
195 0.56
196 0.58
197 0.5
198 0.41
199 0.35
200 0.33
201 0.29
202 0.23
203 0.23
204 0.2
205 0.2
206 0.21
207 0.21
208 0.16
209 0.17
210 0.18
211 0.17
212 0.2
213 0.25
214 0.26
215 0.31
216 0.31
217 0.3