Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059F3T8

Protein Details
Accession A0A059F3T8   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
35-66VIVNKKEIKNGKKFRKKKKKNEKNKSKLATEEBasic
NLS Segment(s)
PositionSequence
39-73KKEIKNGKKFRKKKKKNEKNKSKLATEEEKKIKKK
Subcellular Location(s) nucl 12.5, mito 9, cyto_nucl 9, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MRTLTLIYSMELNDSYIENKKYFNISEDIPDKEIVIVNKKEIKNGKKFRKKKKKNEKNKSKLATEEEKKIKKKYFELKIMNLQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.16
4 0.19
5 0.18
6 0.19
7 0.2
8 0.23
9 0.23
10 0.23
11 0.2
12 0.18
13 0.24
14 0.26
15 0.26
16 0.24
17 0.23
18 0.2
19 0.18
20 0.19
21 0.14
22 0.17
23 0.16
24 0.17
25 0.24
26 0.24
27 0.28
28 0.33
29 0.38
30 0.43
31 0.52
32 0.6
33 0.64
34 0.74
35 0.81
36 0.85
37 0.9
38 0.91
39 0.93
40 0.93
41 0.94
42 0.96
43 0.96
44 0.94
45 0.94
46 0.88
47 0.81
48 0.75
49 0.71
50 0.69
51 0.62
52 0.62
53 0.61
54 0.63
55 0.65
56 0.67
57 0.67
58 0.64
59 0.69
60 0.69
61 0.7
62 0.72
63 0.74
64 0.74