Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059F1J8

Protein Details
Accession A0A059F1J8    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
10-31MKSTKKIVKKVIPPKNLPNNLNHydrophilic
NLS Segment(s)
PositionSequence
6-7AR
10-18MKSTKKIVK
Subcellular Location(s) mito 14, nucl 11, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MTKKRARIVMKSTKKIVKKVIPPKNLPNNLNKNTYEKLITILKEEKQFNIQIITLLSLNEFTTQLSNENIKYTLITNETLSNNDSINIFSYERNTESKRNILFSNRISYNYVPIYLKRNEENEEEIKKKNIDIKNFLVNLTKEEVFVLLHVRKKRFIDICSELEGYSDNLNNTTYVLMVLNSLVKKGYIRRTKDNFYWCISNDLLESFAKKYELPLELIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.74
3 0.74
4 0.72
5 0.72
6 0.75
7 0.77
8 0.78
9 0.79
10 0.82
11 0.83
12 0.82
13 0.76
14 0.76
15 0.76
16 0.72
17 0.71
18 0.63
19 0.57
20 0.51
21 0.5
22 0.41
23 0.31
24 0.3
25 0.29
26 0.27
27 0.27
28 0.29
29 0.31
30 0.35
31 0.36
32 0.34
33 0.33
34 0.33
35 0.29
36 0.27
37 0.23
38 0.17
39 0.17
40 0.16
41 0.12
42 0.11
43 0.1
44 0.08
45 0.08
46 0.08
47 0.08
48 0.07
49 0.08
50 0.08
51 0.1
52 0.11
53 0.13
54 0.12
55 0.14
56 0.14
57 0.13
58 0.13
59 0.13
60 0.13
61 0.13
62 0.13
63 0.13
64 0.16
65 0.16
66 0.17
67 0.16
68 0.15
69 0.13
70 0.13
71 0.12
72 0.08
73 0.1
74 0.11
75 0.11
76 0.1
77 0.12
78 0.13
79 0.15
80 0.18
81 0.19
82 0.21
83 0.23
84 0.28
85 0.27
86 0.28
87 0.28
88 0.28
89 0.29
90 0.27
91 0.31
92 0.26
93 0.27
94 0.27
95 0.25
96 0.25
97 0.21
98 0.2
99 0.15
100 0.15
101 0.19
102 0.19
103 0.21
104 0.2
105 0.22
106 0.23
107 0.24
108 0.27
109 0.27
110 0.29
111 0.29
112 0.29
113 0.29
114 0.26
115 0.26
116 0.3
117 0.29
118 0.3
119 0.33
120 0.35
121 0.39
122 0.4
123 0.39
124 0.35
125 0.31
126 0.27
127 0.25
128 0.22
129 0.15
130 0.15
131 0.15
132 0.1
133 0.1
134 0.13
135 0.13
136 0.18
137 0.23
138 0.25
139 0.29
140 0.31
141 0.39
142 0.39
143 0.37
144 0.4
145 0.41
146 0.41
147 0.41
148 0.4
149 0.32
150 0.27
151 0.26
152 0.19
153 0.15
154 0.14
155 0.11
156 0.11
157 0.11
158 0.11
159 0.11
160 0.1
161 0.08
162 0.07
163 0.07
164 0.06
165 0.06
166 0.07
167 0.1
168 0.1
169 0.1
170 0.1
171 0.1
172 0.13
173 0.2
174 0.29
175 0.34
176 0.41
177 0.51
178 0.58
179 0.65
180 0.7
181 0.71
182 0.65
183 0.61
184 0.6
185 0.51
186 0.49
187 0.41
188 0.35
189 0.28
190 0.24
191 0.21
192 0.17
193 0.18
194 0.14
195 0.16
196 0.16
197 0.15
198 0.17
199 0.22
200 0.23