Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059F038

Protein Details
Accession A0A059F038    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
125-169KESFNKKREPFIKKNDKYKSKGNFNNKSDKFSKFNDQKRRYNDNAHydrophilic
NLS Segment(s)
PositionSequence
112-146KDKEKKDKINSKQKESFNKKREPFIKKNDKYKSKG
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038664  Gar1/Naf1_Cbf5-bd_sf  
IPR007504  H/ACA_rnp_Gar1/Naf1  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0003723  F:RNA binding  
GO:0001522  P:pseudouridine synthesis  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04410  Gar1  
Amino Acid Sequences MAYQPKKKFNNSYNDENAQKIALGKFMHICDNDLVLVLTNKDIPFPNSPVFLNNNKVGVVDEVFGQMDDTYLSVKLDKVFDIKKYKKDDEFYAFDNKFIRKERFLSRDEVQKDKEKKDKINSKQKESFNKKREPFIKKNDKYKSKGNFNNKSDKFSKFNDQKRRYNDNANKYDNKERNNKRNDIANKGSFRNQRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.67
3 0.58
4 0.5
5 0.4
6 0.34
7 0.28
8 0.21
9 0.19
10 0.17
11 0.17
12 0.2
13 0.22
14 0.26
15 0.23
16 0.24
17 0.21
18 0.22
19 0.2
20 0.16
21 0.15
22 0.11
23 0.11
24 0.09
25 0.09
26 0.1
27 0.1
28 0.12
29 0.13
30 0.16
31 0.19
32 0.23
33 0.24
34 0.23
35 0.23
36 0.25
37 0.28
38 0.29
39 0.29
40 0.27
41 0.26
42 0.24
43 0.24
44 0.21
45 0.18
46 0.14
47 0.1
48 0.09
49 0.08
50 0.08
51 0.08
52 0.07
53 0.06
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.06
62 0.08
63 0.09
64 0.09
65 0.12
66 0.14
67 0.19
68 0.29
69 0.32
70 0.38
71 0.44
72 0.48
73 0.48
74 0.49
75 0.49
76 0.45
77 0.43
78 0.38
79 0.4
80 0.35
81 0.32
82 0.31
83 0.27
84 0.25
85 0.27
86 0.27
87 0.21
88 0.26
89 0.32
90 0.35
91 0.37
92 0.38
93 0.36
94 0.41
95 0.42
96 0.42
97 0.37
98 0.41
99 0.44
100 0.45
101 0.5
102 0.47
103 0.51
104 0.57
105 0.64
106 0.65
107 0.71
108 0.72
109 0.73
110 0.76
111 0.76
112 0.77
113 0.77
114 0.77
115 0.75
116 0.78
117 0.72
118 0.73
119 0.75
120 0.74
121 0.73
122 0.73
123 0.76
124 0.74
125 0.81
126 0.82
127 0.81
128 0.77
129 0.77
130 0.75
131 0.75
132 0.77
133 0.78
134 0.78
135 0.74
136 0.8
137 0.73
138 0.7
139 0.63
140 0.59
141 0.53
142 0.47
143 0.53
144 0.52
145 0.6
146 0.64
147 0.69
148 0.72
149 0.76
150 0.81
151 0.75
152 0.77
153 0.76
154 0.76
155 0.76
156 0.75
157 0.73
158 0.71
159 0.76
160 0.71
161 0.69
162 0.69
163 0.71
164 0.74
165 0.76
166 0.76
167 0.7
168 0.74
169 0.73
170 0.72
171 0.7
172 0.68
173 0.65
174 0.63
175 0.67