Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EYY0

Protein Details
Accession A0A059EYY0    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
15-35FNKLKNNKNIKDKIKNKIYNFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11, mito 9, nucl 5
Family & Domain DBs
Amino Acid Sequences EDHFDKYKLIIQEIFNKLKNNKNIKDKIKNKIYNFFIGPNNLEIIELIKKENNINEIIVLGDERLYHQVEGNKIFIPNNGYLKNLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.42
3 0.46
4 0.47
5 0.5
6 0.57
7 0.57
8 0.58
9 0.63
10 0.69
11 0.73
12 0.79
13 0.79
14 0.79
15 0.8
16 0.8
17 0.74
18 0.73
19 0.66
20 0.59
21 0.53
22 0.47
23 0.38
24 0.32
25 0.29
26 0.21
27 0.18
28 0.14
29 0.13
30 0.09
31 0.09
32 0.08
33 0.08
34 0.08
35 0.09
36 0.09
37 0.11
38 0.12
39 0.13
40 0.12
41 0.12
42 0.11
43 0.11
44 0.1
45 0.09
46 0.07
47 0.05
48 0.05
49 0.05
50 0.06
51 0.08
52 0.09
53 0.1
54 0.13
55 0.17
56 0.2
57 0.23
58 0.24
59 0.23
60 0.23
61 0.23
62 0.22
63 0.23
64 0.25
65 0.29
66 0.28