Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059F5F0

Protein Details
Accession A0A059F5F0    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
47-66FDNFKEKKKSSKKVLIEHEDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 18, cyto_nucl 14, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR031533  DUF5093  
Pfam View protein in Pfam  
PF17011  DUF5093  
Amino Acid Sequences SKNFLYVFTFEELIHAKEFMDDPIIFVLNESIYKSREVLEKETNEFFDNFKEKKKSSKKVLIEHEDGFFEYVTEEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.15
3 0.12
4 0.12
5 0.13
6 0.11
7 0.13
8 0.11
9 0.11
10 0.12
11 0.13
12 0.11
13 0.1
14 0.1
15 0.07
16 0.07
17 0.08
18 0.08
19 0.08
20 0.09
21 0.1
22 0.1
23 0.14
24 0.16
25 0.19
26 0.23
27 0.24
28 0.26
29 0.27
30 0.27
31 0.24
32 0.23
33 0.19
34 0.18
35 0.22
36 0.2
37 0.26
38 0.31
39 0.31
40 0.41
41 0.51
42 0.56
43 0.6
44 0.69
45 0.7
46 0.73
47 0.82
48 0.79
49 0.74
50 0.66
51 0.58
52 0.49
53 0.42
54 0.34
55 0.23
56 0.16