Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059F3Y9

Protein Details
Accession A0A059F3Y9    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-28TSKNEYKNKKYPLKMINKKYEEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13, nucl 12.5, mito 12.5
Family & Domain DBs
Amino Acid Sequences MGLTIITSKNEYKNKKYPLKMINKKYEEQKLLIEYLNISDKKSKNCNSRLKIYKNKNIILLRCTWSKCGIRYSPFSNTILENMKFEPFNLILILKLWLDGITTKYLHKCMNISRYTLYKLLRKVAKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.7
3 0.73
4 0.74
5 0.75
6 0.79
7 0.81
8 0.82
9 0.82
10 0.77
11 0.76
12 0.75
13 0.73
14 0.66
15 0.57
16 0.51
17 0.43
18 0.4
19 0.36
20 0.28
21 0.19
22 0.18
23 0.22
24 0.19
25 0.17
26 0.22
27 0.25
28 0.31
29 0.39
30 0.44
31 0.47
32 0.56
33 0.65
34 0.63
35 0.7
36 0.73
37 0.73
38 0.76
39 0.75
40 0.74
41 0.7
42 0.67
43 0.64
44 0.59
45 0.52
46 0.44
47 0.39
48 0.34
49 0.31
50 0.3
51 0.24
52 0.25
53 0.26
54 0.25
55 0.27
56 0.28
57 0.28
58 0.31
59 0.34
60 0.34
61 0.34
62 0.33
63 0.29
64 0.25
65 0.25
66 0.26
67 0.23
68 0.19
69 0.18
70 0.18
71 0.17
72 0.17
73 0.17
74 0.12
75 0.13
76 0.12
77 0.11
78 0.09
79 0.1
80 0.11
81 0.08
82 0.07
83 0.07
84 0.06
85 0.07
86 0.08
87 0.09
88 0.11
89 0.12
90 0.15
91 0.18
92 0.21
93 0.23
94 0.24
95 0.27
96 0.32
97 0.4
98 0.4
99 0.4
100 0.4
101 0.42
102 0.44
103 0.44
104 0.42
105 0.39
106 0.41
107 0.47