Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059F1F3

Protein Details
Accession A0A059F1F3    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MMNHKCKSQRGRSPSNKTDAIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, mito_nucl 13.5, nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024445  Tnp_ISXO2-like  
Pfam View protein in Pfam  
PF12762  DDE_Tnp_IS1595  
Amino Acid Sequences MMNHKCKSQRGRSPSNKTDAIRIIEFNNEITRCYATIIPDKSITTTFPIMEKIVLNGSTIYADEHKSYQRLNMLGYQHVTVYYRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.81
3 0.77
4 0.67
5 0.65
6 0.58
7 0.52
8 0.43
9 0.38
10 0.32
11 0.28
12 0.27
13 0.22
14 0.21
15 0.17
16 0.16
17 0.16
18 0.16
19 0.13
20 0.15
21 0.14
22 0.12
23 0.19
24 0.19
25 0.19
26 0.2
27 0.2
28 0.19
29 0.18
30 0.16
31 0.13
32 0.12
33 0.11
34 0.11
35 0.12
36 0.11
37 0.11
38 0.11
39 0.09
40 0.1
41 0.1
42 0.09
43 0.08
44 0.08
45 0.08
46 0.08
47 0.08
48 0.08
49 0.09
50 0.1
51 0.13
52 0.15
53 0.17
54 0.17
55 0.2
56 0.23
57 0.23
58 0.24
59 0.27
60 0.27
61 0.28
62 0.3
63 0.26
64 0.22
65 0.22