Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EZ69

Protein Details
Accession A0A059EZ69    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
50-69YKKSKLKYAGFKKKRFMNLFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, mito_nucl 12.666, nucl 8.5, cyto_nucl 6.833
Family & Domain DBs
Amino Acid Sequences MRKSILMSNKLYLEEGNICREVVANDDLIRLDEILNKLHLPSHLGMTAMYKKSKLKYAGFKKKRFMNLFQIALPAKSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.23
4 0.22
5 0.21
6 0.2
7 0.21
8 0.18
9 0.14
10 0.13
11 0.11
12 0.1
13 0.11
14 0.11
15 0.11
16 0.11
17 0.08
18 0.07
19 0.09
20 0.1
21 0.1
22 0.11
23 0.1
24 0.1
25 0.11
26 0.1
27 0.1
28 0.1
29 0.1
30 0.1
31 0.1
32 0.1
33 0.12
34 0.17
35 0.17
36 0.17
37 0.18
38 0.21
39 0.23
40 0.3
41 0.33
42 0.35
43 0.43
44 0.54
45 0.64
46 0.7
47 0.74
48 0.76
49 0.78
50 0.81
51 0.76
52 0.71
53 0.7
54 0.69
55 0.65
56 0.58
57 0.55
58 0.46