Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059F5L9

Protein Details
Accession A0A059F5L9    Localization Confidence High Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MKSIDKKVSFKKLKVKLKKKNNEFNKKISDEHydrophilic
125-156DIENKFMEIKKQKKNIKKKIDDYKKTNENKSIHydrophilic
NLS Segment(s)
PositionSequence
8-21VSFKKLKVKLKKKN
134-143KKQKKNIKKK
Subcellular Location(s) nucl 18, cyto_nucl 12, mito 5, cyto 4
Family & Domain DBs
Amino Acid Sequences MKSIDKKVSFKKLKVKLKKKNNEFNKKISDEVNKRYEEKRNELKTLLINKSKEFSQFINDNFEKINNLVKKNEQNFKEFNNEYKILIKKSGKFDEQNNEFKREISALKKEINNFISQKKNQLEKDIENKFMEIKKQKKNIKKKIDDYKKTNENKSIKSIISELL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.86
3 0.85
4 0.88
5 0.92
6 0.92
7 0.92
8 0.93
9 0.93
10 0.87
11 0.85
12 0.83
13 0.75
14 0.67
15 0.62
16 0.61
17 0.57
18 0.59
19 0.57
20 0.51
21 0.52
22 0.55
23 0.58
24 0.54
25 0.55
26 0.58
27 0.57
28 0.57
29 0.54
30 0.52
31 0.5
32 0.51
33 0.49
34 0.45
35 0.4
36 0.38
37 0.39
38 0.38
39 0.34
40 0.28
41 0.22
42 0.22
43 0.24
44 0.25
45 0.31
46 0.3
47 0.28
48 0.26
49 0.25
50 0.2
51 0.17
52 0.23
53 0.19
54 0.21
55 0.22
56 0.26
57 0.33
58 0.38
59 0.44
60 0.39
61 0.39
62 0.39
63 0.39
64 0.42
65 0.35
66 0.32
67 0.3
68 0.29
69 0.26
70 0.29
71 0.29
72 0.22
73 0.27
74 0.28
75 0.27
76 0.33
77 0.37
78 0.35
79 0.36
80 0.39
81 0.43
82 0.46
83 0.5
84 0.46
85 0.46
86 0.43
87 0.41
88 0.37
89 0.3
90 0.27
91 0.23
92 0.26
93 0.25
94 0.3
95 0.32
96 0.33
97 0.37
98 0.35
99 0.35
100 0.32
101 0.35
102 0.39
103 0.37
104 0.44
105 0.44
106 0.5
107 0.46
108 0.51
109 0.5
110 0.48
111 0.56
112 0.52
113 0.5
114 0.43
115 0.42
116 0.39
117 0.36
118 0.39
119 0.39
120 0.44
121 0.49
122 0.58
123 0.66
124 0.73
125 0.82
126 0.84
127 0.86
128 0.87
129 0.88
130 0.9
131 0.92
132 0.91
133 0.87
134 0.87
135 0.85
136 0.83
137 0.8
138 0.78
139 0.75
140 0.7
141 0.7
142 0.65
143 0.56
144 0.52