Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EZJ4

Protein Details
Accession A0A059EZJ4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
304-323GIKLCSKRFGSKSKKIRFFFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, plas 7, E.R. 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001915  Peptidase_M48  
Gene Ontology GO:0016020  C:membrane  
GO:0046872  F:metal ion binding  
GO:0004222  F:metalloendopeptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF01435  Peptidase_M48  
Amino Acid Sequences MSKSFTTKILLFLALLYNSFLFYVFLDLKRYKTLLYKNRNIFGNKTVDELINSSHIETFRKKELQNILNQNKTLLVDLILFWTLMLINLLFYNDHTRNIIVKQSKKYLKRIIDLCCVENDEKSAVLIFYTNLMILANLLYFTPFLSFWKNVLLYFCYVNLLILNQKYIYSFDITKIRKRMYFLFTLTIFLVSEVFHTVTIHYVYKDKKGKIPAFLHGEPLELATKHFDIENIYFNNQNGINMCSSYKLFTNILIVLGNWASFTKKEITSVVAHEIGHGGIVLKYFSSFVYCVIKVFSLYIYSLGIKLCSKRFGSKSKKIRFFFFYSNIYFLYLFCNLFTNIVKQSMEYFADNQVSTIFPQNELSKALFKMYILDDPIFYMQRFYSCFKKNHPSFYHRILEHEKNRIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.15
4 0.12
5 0.12
6 0.12
7 0.11
8 0.08
9 0.08
10 0.13
11 0.15
12 0.16
13 0.22
14 0.24
15 0.26
16 0.3
17 0.3
18 0.28
19 0.32
20 0.42
21 0.46
22 0.54
23 0.61
24 0.65
25 0.7
26 0.74
27 0.69
28 0.63
29 0.59
30 0.57
31 0.48
32 0.44
33 0.39
34 0.34
35 0.31
36 0.29
37 0.24
38 0.19
39 0.19
40 0.16
41 0.17
42 0.18
43 0.21
44 0.24
45 0.27
46 0.32
47 0.38
48 0.38
49 0.43
50 0.52
51 0.53
52 0.58
53 0.65
54 0.65
55 0.64
56 0.63
57 0.56
58 0.47
59 0.42
60 0.33
61 0.23
62 0.16
63 0.11
64 0.11
65 0.12
66 0.11
67 0.1
68 0.08
69 0.08
70 0.07
71 0.06
72 0.06
73 0.04
74 0.05
75 0.05
76 0.06
77 0.06
78 0.07
79 0.14
80 0.15
81 0.16
82 0.17
83 0.18
84 0.2
85 0.22
86 0.28
87 0.29
88 0.35
89 0.39
90 0.48
91 0.55
92 0.59
93 0.66
94 0.67
95 0.66
96 0.66
97 0.67
98 0.63
99 0.64
100 0.6
101 0.52
102 0.44
103 0.42
104 0.34
105 0.29
106 0.24
107 0.16
108 0.13
109 0.12
110 0.11
111 0.08
112 0.07
113 0.07
114 0.06
115 0.06
116 0.06
117 0.06
118 0.06
119 0.06
120 0.05
121 0.05
122 0.05
123 0.04
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.05
130 0.05
131 0.07
132 0.11
133 0.12
134 0.12
135 0.16
136 0.17
137 0.16
138 0.18
139 0.18
140 0.15
141 0.15
142 0.15
143 0.11
144 0.11
145 0.1
146 0.09
147 0.08
148 0.09
149 0.09
150 0.09
151 0.08
152 0.09
153 0.09
154 0.1
155 0.11
156 0.1
157 0.11
158 0.13
159 0.21
160 0.23
161 0.28
162 0.32
163 0.34
164 0.33
165 0.35
166 0.38
167 0.34
168 0.36
169 0.32
170 0.31
171 0.28
172 0.27
173 0.25
174 0.19
175 0.15
176 0.11
177 0.09
178 0.06
179 0.06
180 0.06
181 0.06
182 0.06
183 0.06
184 0.06
185 0.07
186 0.08
187 0.08
188 0.08
189 0.12
190 0.13
191 0.21
192 0.27
193 0.27
194 0.3
195 0.38
196 0.41
197 0.45
198 0.46
199 0.44
200 0.45
201 0.44
202 0.42
203 0.34
204 0.31
205 0.23
206 0.22
207 0.17
208 0.09
209 0.1
210 0.09
211 0.09
212 0.08
213 0.08
214 0.08
215 0.09
216 0.11
217 0.15
218 0.15
219 0.16
220 0.16
221 0.16
222 0.18
223 0.16
224 0.15
225 0.12
226 0.12
227 0.11
228 0.11
229 0.11
230 0.1
231 0.1
232 0.11
233 0.1
234 0.12
235 0.11
236 0.11
237 0.13
238 0.12
239 0.12
240 0.11
241 0.1
242 0.09
243 0.08
244 0.08
245 0.06
246 0.06
247 0.06
248 0.06
249 0.09
250 0.12
251 0.12
252 0.14
253 0.14
254 0.17
255 0.18
256 0.2
257 0.21
258 0.18
259 0.18
260 0.17
261 0.16
262 0.13
263 0.11
264 0.09
265 0.06
266 0.05
267 0.05
268 0.05
269 0.05
270 0.05
271 0.06
272 0.06
273 0.08
274 0.07
275 0.09
276 0.14
277 0.14
278 0.15
279 0.15
280 0.15
281 0.14
282 0.14
283 0.12
284 0.09
285 0.09
286 0.09
287 0.09
288 0.09
289 0.1
290 0.1
291 0.11
292 0.12
293 0.16
294 0.18
295 0.22
296 0.24
297 0.31
298 0.37
299 0.46
300 0.54
301 0.6
302 0.68
303 0.74
304 0.81
305 0.76
306 0.76
307 0.72
308 0.68
309 0.64
310 0.59
311 0.54
312 0.46
313 0.46
314 0.4
315 0.35
316 0.29
317 0.22
318 0.2
319 0.17
320 0.15
321 0.14
322 0.16
323 0.14
324 0.17
325 0.18
326 0.17
327 0.17
328 0.2
329 0.2
330 0.18
331 0.2
332 0.21
333 0.23
334 0.21
335 0.2
336 0.21
337 0.24
338 0.23
339 0.21
340 0.18
341 0.17
342 0.17
343 0.23
344 0.2
345 0.17
346 0.22
347 0.23
348 0.24
349 0.26
350 0.27
351 0.23
352 0.23
353 0.24
354 0.21
355 0.19
356 0.22
357 0.22
358 0.24
359 0.23
360 0.23
361 0.21
362 0.22
363 0.25
364 0.23
365 0.2
366 0.19
367 0.16
368 0.19
369 0.23
370 0.24
371 0.3
372 0.36
373 0.42
374 0.48
375 0.58
376 0.61
377 0.68
378 0.72
379 0.72
380 0.71
381 0.74
382 0.75
383 0.64
384 0.66
385 0.63
386 0.65
387 0.65