Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059F2X0

Protein Details
Accession A0A059F2X0    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
35-69PVCCNKTMILRKRHDRKNKGYSYRCNNRNWRKELPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 7
Family & Domain DBs
Amino Acid Sequences MNIDLIKESAFFALIDTEESTIKLLQNQGLLIKDPVCCNKTMILRKRHDRKNKGYSYRCNNRNWRKELP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.09
4 0.09
5 0.09
6 0.09
7 0.1
8 0.1
9 0.1
10 0.1
11 0.11
12 0.11
13 0.12
14 0.12
15 0.13
16 0.12
17 0.13
18 0.11
19 0.11
20 0.11
21 0.12
22 0.15
23 0.15
24 0.15
25 0.15
26 0.18
27 0.25
28 0.33
29 0.4
30 0.46
31 0.52
32 0.62
33 0.71
34 0.77
35 0.8
36 0.8
37 0.83
38 0.84
39 0.87
40 0.87
41 0.86
42 0.86
43 0.86
44 0.87
45 0.83
46 0.82
47 0.83
48 0.83
49 0.85