Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059F2W2

Protein Details
Accession A0A059F2W2    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
48-75INNKIIITFKNKKKPSRKNKTRTLFTPHHydrophilic
NLS Segment(s)
PositionSequence
57-67KNKKKPSRKNK
Subcellular Location(s) nucl 19, cyto_nucl 14, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036511  TGT-like_sf  
Gene Ontology GO:0016763  F:pentosyltransferase activity  
GO:0006400  P:tRNA modification  
Amino Acid Sequences MDYLISTEQCCVPYILKIETNQPILVYLDDIFEHYQKNTTPINTLMNINNKIIITFKNKKKPSRKNKTRTLFTPHGNRLITETEYSSLIKVISPFYHEDFNTFVIKNDNESFEYFAPKDFYEAISFLKENKLIDTSFLYDLTKNGKLIINKDIVSVNDEYTCECCCKSEYLRHLYKLNEINAYITLQRHNLLAWDNIVKEIKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.25
4 0.26
5 0.31
6 0.35
7 0.36
8 0.32
9 0.29
10 0.26
11 0.23
12 0.22
13 0.17
14 0.12
15 0.1
16 0.1
17 0.12
18 0.12
19 0.12
20 0.13
21 0.12
22 0.15
23 0.15
24 0.19
25 0.21
26 0.2
27 0.22
28 0.23
29 0.26
30 0.25
31 0.27
32 0.27
33 0.31
34 0.32
35 0.3
36 0.29
37 0.25
38 0.24
39 0.22
40 0.21
41 0.23
42 0.3
43 0.39
44 0.47
45 0.54
46 0.63
47 0.73
48 0.8
49 0.83
50 0.85
51 0.87
52 0.87
53 0.91
54 0.91
55 0.87
56 0.81
57 0.79
58 0.74
59 0.68
60 0.68
61 0.6
62 0.56
63 0.49
64 0.44
65 0.37
66 0.33
67 0.29
68 0.2
69 0.18
70 0.13
71 0.14
72 0.14
73 0.11
74 0.09
75 0.08
76 0.08
77 0.08
78 0.08
79 0.07
80 0.09
81 0.11
82 0.12
83 0.14
84 0.14
85 0.14
86 0.14
87 0.16
88 0.15
89 0.14
90 0.13
91 0.13
92 0.13
93 0.15
94 0.15
95 0.14
96 0.14
97 0.14
98 0.16
99 0.14
100 0.17
101 0.14
102 0.14
103 0.14
104 0.12
105 0.13
106 0.11
107 0.12
108 0.1
109 0.11
110 0.11
111 0.11
112 0.12
113 0.11
114 0.13
115 0.13
116 0.12
117 0.13
118 0.14
119 0.12
120 0.13
121 0.14
122 0.15
123 0.14
124 0.15
125 0.14
126 0.13
127 0.14
128 0.17
129 0.17
130 0.14
131 0.16
132 0.18
133 0.2
134 0.22
135 0.26
136 0.25
137 0.24
138 0.25
139 0.24
140 0.21
141 0.23
142 0.21
143 0.17
144 0.14
145 0.14
146 0.14
147 0.14
148 0.15
149 0.13
150 0.12
151 0.13
152 0.13
153 0.18
154 0.23
155 0.3
156 0.37
157 0.45
158 0.51
159 0.54
160 0.56
161 0.52
162 0.55
163 0.52
164 0.48
165 0.41
166 0.35
167 0.33
168 0.3
169 0.3
170 0.25
171 0.2
172 0.19
173 0.18
174 0.18
175 0.17
176 0.16
177 0.17
178 0.17
179 0.18
180 0.19
181 0.2
182 0.2
183 0.24