Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059F5Q4

Protein Details
Accession A0A059F5Q4    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
71-106LKAVKDIKTNPQKKNKKIIKKRRKKINLDEPLRHCMHydrophilic
NLS Segment(s)
PositionSequence
80-95NPQKKNKKIIKKRRKK
Subcellular Location(s) nucl 26
Family & Domain DBs
Amino Acid Sequences MSDDFTDENKKEKSFKQEVWDRSNATNENNTENKIIIQDNNNLQINYNISTNNEVTLNNKYDANHSSDNSLKAVKDIKTNPQKKNKKIIKKRRKKINLDEPLRHCMVFDRKKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.51
3 0.55
4 0.6
5 0.65
6 0.66
7 0.66
8 0.59
9 0.53
10 0.54
11 0.46
12 0.4
13 0.39
14 0.33
15 0.34
16 0.32
17 0.32
18 0.27
19 0.25
20 0.23
21 0.19
22 0.19
23 0.15
24 0.17
25 0.2
26 0.21
27 0.26
28 0.26
29 0.24
30 0.23
31 0.22
32 0.2
33 0.17
34 0.15
35 0.11
36 0.1
37 0.12
38 0.12
39 0.11
40 0.1
41 0.09
42 0.11
43 0.14
44 0.15
45 0.14
46 0.14
47 0.14
48 0.16
49 0.18
50 0.21
51 0.2
52 0.18
53 0.2
54 0.22
55 0.23
56 0.21
57 0.21
58 0.15
59 0.15
60 0.19
61 0.18
62 0.22
63 0.24
64 0.33
65 0.42
66 0.51
67 0.58
68 0.64
69 0.72
70 0.73
71 0.81
72 0.81
73 0.82
74 0.85
75 0.88
76 0.88
77 0.9
78 0.93
79 0.93
80 0.94
81 0.93
82 0.93
83 0.92
84 0.92
85 0.89
86 0.89
87 0.82
88 0.78
89 0.7
90 0.58
91 0.47
92 0.44
93 0.46