Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059F1M5

Protein Details
Accession A0A059F1M5    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
560-583QKFSVTKQLRKKFSKYLIKNQEDEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 15, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031327  MCM  
IPR008045  MCM2  
IPR001208  MCM_dom  
IPR041562  MCM_lid  
IPR033762  MCM_OB  
IPR012340  NA-bd_OB-fold  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0031261  C:DNA replication preinitiation complex  
GO:0042555  C:MCM complex  
GO:0005656  C:nuclear pre-replicative complex  
GO:0043596  C:nuclear replication fork  
GO:0005524  F:ATP binding  
GO:0003677  F:DNA binding  
GO:0032508  P:DNA duplex unwinding  
GO:0006270  P:DNA replication initiation  
GO:1905775  P:negative regulation of DNA helicase activity  
GO:0033260  P:nuclear DNA replication  
GO:0030174  P:regulation of DNA-templated DNA replication initiation  
Pfam View protein in Pfam  
PF00493  MCM  
PF17855  MCM_lid  
PF17207  MCM_OB  
PROSITE View protein in PROSITE  
PS50051  MCM_2  
Amino Acid Sequences DYLDLETFSDAIIKSLLCKPEETLFFLDKGLELAVKEFFPNYSKIKQKVHTRILNLPVLENIRELRNLHLNTLIKVGGIVTRVSNILPQINIVKFICTRCNGTFGPYVVDKPDFKPANCFECNSRGPFLINSQETLYKDYQKITIQEVPGSVLPGNLPRNKEVICFFDLIDKTKPGDEVEIVGIYKNNFCFSLNNKNGFPVFSTVIEANSILNKQNEFSTLKINEDDIKLIEKYSKKENIKEIIFNSLAPSIFGHMDIKKAIALSLFSGVRKIYKDKIVRGDINVLMLGDPGTAKSQFLRYIQGIMHRSVLTTGKGASSVGLTASVQKDPVTKEWTLEGGALVLADGGICMIDEFDKMNENDRVSIHEAMEQQTVSISKAGIITSLNARCGIIAAANPLRGQYNQSINFHQNVNLSDPIISRFDILCVVKDIIDVDLDSKMGKFVLENHSNTIIEFQEKKRKQEEKEIMDQDLLKKYIVYARNNIKPVIKEIDLEKISQFYTEIRKESLTSCGIPITVRNIESIIRMSEAFAKMRLSNVVTQQDIDDAIYVALNSFINAQKFSVTKQLRKKFSKYLIKNQEDEILFFVLNDIFNERMKCTGISNVSVDKNDFEKVARGQGFKISKMFYQSKKFLNGYLVEGGKIKRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.2
3 0.24
4 0.22
5 0.24
6 0.26
7 0.33
8 0.35
9 0.36
10 0.35
11 0.33
12 0.33
13 0.32
14 0.29
15 0.21
16 0.2
17 0.16
18 0.12
19 0.1
20 0.11
21 0.12
22 0.12
23 0.13
24 0.13
25 0.13
26 0.15
27 0.19
28 0.23
29 0.3
30 0.38
31 0.44
32 0.52
33 0.58
34 0.66
35 0.72
36 0.77
37 0.76
38 0.73
39 0.74
40 0.73
41 0.7
42 0.59
43 0.5
44 0.44
45 0.39
46 0.34
47 0.28
48 0.23
49 0.2
50 0.23
51 0.23
52 0.23
53 0.3
54 0.3
55 0.29
56 0.35
57 0.34
58 0.32
59 0.34
60 0.29
61 0.2
62 0.19
63 0.18
64 0.13
65 0.12
66 0.12
67 0.1
68 0.11
69 0.12
70 0.12
71 0.13
72 0.13
73 0.14
74 0.14
75 0.15
76 0.2
77 0.2
78 0.23
79 0.22
80 0.23
81 0.23
82 0.26
83 0.3
84 0.27
85 0.32
86 0.29
87 0.35
88 0.32
89 0.34
90 0.35
91 0.3
92 0.32
93 0.28
94 0.28
95 0.25
96 0.28
97 0.26
98 0.23
99 0.32
100 0.32
101 0.31
102 0.38
103 0.4
104 0.44
105 0.44
106 0.44
107 0.38
108 0.42
109 0.45
110 0.41
111 0.38
112 0.31
113 0.31
114 0.3
115 0.31
116 0.31
117 0.28
118 0.25
119 0.25
120 0.28
121 0.27
122 0.31
123 0.29
124 0.27
125 0.28
126 0.28
127 0.3
128 0.3
129 0.31
130 0.32
131 0.34
132 0.3
133 0.29
134 0.28
135 0.26
136 0.23
137 0.22
138 0.17
139 0.12
140 0.11
141 0.15
142 0.21
143 0.22
144 0.24
145 0.24
146 0.28
147 0.28
148 0.3
149 0.27
150 0.25
151 0.24
152 0.23
153 0.21
154 0.25
155 0.25
156 0.26
157 0.27
158 0.24
159 0.22
160 0.22
161 0.23
162 0.17
163 0.18
164 0.15
165 0.14
166 0.14
167 0.14
168 0.13
169 0.12
170 0.12
171 0.11
172 0.13
173 0.12
174 0.11
175 0.11
176 0.12
177 0.15
178 0.19
179 0.29
180 0.33
181 0.36
182 0.35
183 0.37
184 0.37
185 0.34
186 0.3
187 0.22
188 0.18
189 0.15
190 0.17
191 0.15
192 0.14
193 0.14
194 0.13
195 0.1
196 0.1
197 0.1
198 0.11
199 0.12
200 0.12
201 0.12
202 0.13
203 0.16
204 0.16
205 0.16
206 0.21
207 0.2
208 0.22
209 0.21
210 0.22
211 0.21
212 0.2
213 0.2
214 0.13
215 0.15
216 0.13
217 0.13
218 0.17
219 0.18
220 0.2
221 0.26
222 0.35
223 0.36
224 0.41
225 0.47
226 0.49
227 0.48
228 0.49
229 0.43
230 0.39
231 0.36
232 0.31
233 0.25
234 0.2
235 0.17
236 0.14
237 0.13
238 0.09
239 0.09
240 0.09
241 0.11
242 0.09
243 0.11
244 0.1
245 0.11
246 0.1
247 0.09
248 0.09
249 0.07
250 0.07
251 0.06
252 0.09
253 0.1
254 0.09
255 0.1
256 0.1
257 0.12
258 0.13
259 0.16
260 0.16
261 0.23
262 0.28
263 0.32
264 0.39
265 0.42
266 0.42
267 0.4
268 0.4
269 0.33
270 0.29
271 0.24
272 0.17
273 0.11
274 0.1
275 0.08
276 0.04
277 0.04
278 0.04
279 0.05
280 0.05
281 0.05
282 0.06
283 0.08
284 0.11
285 0.12
286 0.15
287 0.14
288 0.16
289 0.16
290 0.21
291 0.21
292 0.2
293 0.21
294 0.17
295 0.17
296 0.16
297 0.17
298 0.12
299 0.1
300 0.1
301 0.08
302 0.08
303 0.08
304 0.07
305 0.05
306 0.05
307 0.04
308 0.04
309 0.04
310 0.07
311 0.08
312 0.08
313 0.08
314 0.08
315 0.1
316 0.12
317 0.15
318 0.16
319 0.15
320 0.16
321 0.16
322 0.17
323 0.15
324 0.13
325 0.1
326 0.06
327 0.06
328 0.05
329 0.04
330 0.03
331 0.02
332 0.02
333 0.02
334 0.02
335 0.02
336 0.02
337 0.02
338 0.02
339 0.02
340 0.03
341 0.03
342 0.04
343 0.07
344 0.07
345 0.11
346 0.14
347 0.14
348 0.15
349 0.15
350 0.18
351 0.19
352 0.2
353 0.16
354 0.17
355 0.18
356 0.18
357 0.19
358 0.15
359 0.12
360 0.12
361 0.12
362 0.09
363 0.08
364 0.06
365 0.06
366 0.07
367 0.07
368 0.07
369 0.07
370 0.07
371 0.12
372 0.13
373 0.13
374 0.12
375 0.12
376 0.11
377 0.12
378 0.11
379 0.06
380 0.06
381 0.09
382 0.1
383 0.11
384 0.11
385 0.11
386 0.12
387 0.12
388 0.14
389 0.15
390 0.22
391 0.25
392 0.28
393 0.31
394 0.32
395 0.33
396 0.31
397 0.29
398 0.23
399 0.2
400 0.21
401 0.18
402 0.17
403 0.16
404 0.15
405 0.15
406 0.14
407 0.13
408 0.11
409 0.11
410 0.11
411 0.14
412 0.13
413 0.12
414 0.13
415 0.14
416 0.12
417 0.12
418 0.12
419 0.09
420 0.09
421 0.08
422 0.06
423 0.06
424 0.06
425 0.06
426 0.06
427 0.06
428 0.06
429 0.06
430 0.05
431 0.1
432 0.19
433 0.24
434 0.25
435 0.28
436 0.3
437 0.3
438 0.3
439 0.27
440 0.19
441 0.17
442 0.2
443 0.22
444 0.31
445 0.34
446 0.39
447 0.47
448 0.53
449 0.54
450 0.61
451 0.66
452 0.62
453 0.68
454 0.66
455 0.58
456 0.52
457 0.49
458 0.42
459 0.36
460 0.3
461 0.2
462 0.18
463 0.17
464 0.23
465 0.28
466 0.28
467 0.31
468 0.39
469 0.46
470 0.48
471 0.49
472 0.46
473 0.41
474 0.41
475 0.39
476 0.31
477 0.26
478 0.26
479 0.32
480 0.29
481 0.29
482 0.25
483 0.21
484 0.2
485 0.19
486 0.18
487 0.12
488 0.2
489 0.23
490 0.24
491 0.24
492 0.25
493 0.27
494 0.27
495 0.29
496 0.24
497 0.22
498 0.2
499 0.19
500 0.19
501 0.17
502 0.17
503 0.18
504 0.18
505 0.17
506 0.17
507 0.17
508 0.18
509 0.19
510 0.19
511 0.15
512 0.13
513 0.12
514 0.13
515 0.18
516 0.2
517 0.19
518 0.19
519 0.2
520 0.19
521 0.21
522 0.22
523 0.19
524 0.21
525 0.26
526 0.29
527 0.27
528 0.27
529 0.26
530 0.24
531 0.22
532 0.18
533 0.12
534 0.08
535 0.08
536 0.07
537 0.07
538 0.06
539 0.07
540 0.06
541 0.06
542 0.09
543 0.12
544 0.13
545 0.14
546 0.15
547 0.16
548 0.17
549 0.19
550 0.27
551 0.31
552 0.38
553 0.48
554 0.57
555 0.64
556 0.7
557 0.75
558 0.75
559 0.78
560 0.81
561 0.79
562 0.81
563 0.82
564 0.8
565 0.76
566 0.68
567 0.65
568 0.55
569 0.47
570 0.38
571 0.29
572 0.23
573 0.2
574 0.19
575 0.13
576 0.12
577 0.12
578 0.12
579 0.12
580 0.15
581 0.17
582 0.17
583 0.18
584 0.2
585 0.2
586 0.19
587 0.25
588 0.26
589 0.27
590 0.3
591 0.33
592 0.35
593 0.35
594 0.35
595 0.3
596 0.28
597 0.26
598 0.24
599 0.2
600 0.23
601 0.23
602 0.31
603 0.33
604 0.33
605 0.33
606 0.41
607 0.43
608 0.4
609 0.43
610 0.36
611 0.34
612 0.4
613 0.47
614 0.46
615 0.52
616 0.55
617 0.57
618 0.62
619 0.61
620 0.56
621 0.54
622 0.48
623 0.44
624 0.44
625 0.38
626 0.31
627 0.34