Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059F0R4

Protein Details
Accession A0A059F0R4   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
6-41QESKQKKLAKAQSQSHKEKKKWSSGKQKDVLRRKVYHydrophilic
NLS Segment(s)
PositionSequence
9-33KQKKLAKAQSQSHKEKKKWSSGKQK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.833, mito_nucl 12.666, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MVKKVQESKQKKLAKAQSQSHKEKKKWSSGKQKDVLRRKVYVDDETMAKIEKEIVKMSVVTKTSLAEKFNINVGVSQLLLELFESKGLIVSISKSATIKIYGKLEKVGEEEVLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.75
3 0.75
4 0.76
5 0.78
6 0.84
7 0.84
8 0.83
9 0.77
10 0.78
11 0.76
12 0.77
13 0.77
14 0.78
15 0.79
16 0.8
17 0.85
18 0.83
19 0.83
20 0.82
21 0.82
22 0.81
23 0.74
24 0.67
25 0.59
26 0.58
27 0.54
28 0.47
29 0.39
30 0.31
31 0.27
32 0.25
33 0.22
34 0.16
35 0.13
36 0.1
37 0.11
38 0.11
39 0.11
40 0.11
41 0.11
42 0.11
43 0.12
44 0.13
45 0.14
46 0.13
47 0.12
48 0.11
49 0.11
50 0.14
51 0.16
52 0.16
53 0.14
54 0.14
55 0.14
56 0.16
57 0.17
58 0.13
59 0.12
60 0.12
61 0.11
62 0.09
63 0.09
64 0.07
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.05
73 0.06
74 0.06
75 0.06
76 0.05
77 0.07
78 0.09
79 0.1
80 0.11
81 0.11
82 0.12
83 0.14
84 0.18
85 0.19
86 0.21
87 0.28
88 0.3
89 0.31
90 0.35
91 0.34
92 0.32
93 0.32
94 0.29