Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059F3U0

Protein Details
Accession A0A059F3U0    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MDNKRVKTGKIKHKIKEKNEAVEBasic
NLS Segment(s)
PositionSequence
7-16KTGKIKHKIK
Subcellular Location(s) nucl 18, cyto 5, mito 4
Family & Domain DBs
Amino Acid Sequences MDNKRVKTGKIKHKIKEKNEAVEEITDRTIKHEKISNNKDKKLIDKKNEEEAVETNESPKEINDSKVDKKESSDINSECKTNGMNNEKNNSKNKNVFSPFLIQSNKEKETIFDNKSNESNKVISSFITSKIKLNNSQDKIETDLKNINILFKDDLMLYILKDNKFIGLGGGTLIVSDEKERITFIREKIKTLAFDYYNNKKGSIKGNVVKIFVPIVKEPYFELYALKFNSEDKAKEFYEFIKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.84
3 0.85
4 0.81
5 0.79
6 0.74
7 0.69
8 0.6
9 0.54
10 0.48
11 0.39
12 0.34
13 0.26
14 0.22
15 0.24
16 0.29
17 0.26
18 0.29
19 0.33
20 0.37
21 0.47
22 0.57
23 0.63
24 0.65
25 0.68
26 0.7
27 0.66
28 0.7
29 0.7
30 0.69
31 0.68
32 0.69
33 0.69
34 0.72
35 0.72
36 0.62
37 0.54
38 0.46
39 0.42
40 0.35
41 0.31
42 0.23
43 0.2
44 0.2
45 0.18
46 0.16
47 0.16
48 0.15
49 0.18
50 0.23
51 0.28
52 0.34
53 0.4
54 0.43
55 0.38
56 0.38
57 0.41
58 0.4
59 0.39
60 0.39
61 0.34
62 0.37
63 0.38
64 0.35
65 0.3
66 0.26
67 0.23
68 0.18
69 0.24
70 0.26
71 0.3
72 0.33
73 0.39
74 0.42
75 0.46
76 0.51
77 0.48
78 0.46
79 0.48
80 0.47
81 0.5
82 0.49
83 0.45
84 0.4
85 0.41
86 0.36
87 0.35
88 0.33
89 0.26
90 0.28
91 0.32
92 0.31
93 0.26
94 0.25
95 0.21
96 0.26
97 0.31
98 0.3
99 0.29
100 0.29
101 0.29
102 0.33
103 0.34
104 0.29
105 0.24
106 0.21
107 0.17
108 0.17
109 0.16
110 0.12
111 0.14
112 0.14
113 0.15
114 0.18
115 0.18
116 0.18
117 0.23
118 0.25
119 0.27
120 0.33
121 0.39
122 0.39
123 0.4
124 0.39
125 0.36
126 0.38
127 0.39
128 0.33
129 0.26
130 0.27
131 0.25
132 0.26
133 0.25
134 0.22
135 0.16
136 0.17
137 0.15
138 0.12
139 0.13
140 0.1
141 0.1
142 0.09
143 0.09
144 0.07
145 0.11
146 0.15
147 0.14
148 0.15
149 0.15
150 0.13
151 0.14
152 0.13
153 0.1
154 0.06
155 0.06
156 0.06
157 0.06
158 0.05
159 0.05
160 0.05
161 0.04
162 0.04
163 0.05
164 0.06
165 0.06
166 0.07
167 0.08
168 0.08
169 0.13
170 0.18
171 0.22
172 0.32
173 0.32
174 0.35
175 0.38
176 0.41
177 0.38
178 0.35
179 0.38
180 0.29
181 0.34
182 0.38
183 0.43
184 0.46
185 0.45
186 0.44
187 0.39
188 0.42
189 0.44
190 0.45
191 0.45
192 0.44
193 0.52
194 0.53
195 0.53
196 0.49
197 0.42
198 0.37
199 0.3
200 0.27
201 0.2
202 0.23
203 0.23
204 0.23
205 0.23
206 0.25
207 0.25
208 0.22
209 0.22
210 0.18
211 0.24
212 0.24
213 0.24
214 0.19
215 0.19
216 0.25
217 0.28
218 0.28
219 0.26
220 0.31
221 0.3
222 0.32
223 0.32