Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EYI9

Protein Details
Accession A0A059EYI9   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-28AEREEKSKESKKYKGIKQNKKKLNVIEHydrophilic
101-120AFFIWFFLKKKKKKAFLNIFHydrophilic
NLS Segment(s)
PositionSequence
8-23SKESKKYKGIKQNKKK
109-114KKKKKK
Subcellular Location(s) nucl 15, cyto_nucl 11, mito 7, cyto 5
Family & Domain DBs
Amino Acid Sequences MAEREEKSKESKKYKGIKQNKKKLNVIEAIYKLIGYNLKTIGLLFKDLKKRKVNSLNRESCEGLIEDCKGIKKRVSFILNDNEKFKLFYKNYSFKFTYTEAFFIWFFLKKKKKKAFLNIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.83
4 0.85
5 0.87
6 0.9
7 0.89
8 0.87
9 0.84
10 0.79
11 0.75
12 0.7
13 0.62
14 0.58
15 0.51
16 0.44
17 0.38
18 0.32
19 0.24
20 0.19
21 0.18
22 0.12
23 0.13
24 0.12
25 0.12
26 0.12
27 0.12
28 0.13
29 0.11
30 0.13
31 0.13
32 0.18
33 0.27
34 0.31
35 0.39
36 0.44
37 0.46
38 0.52
39 0.61
40 0.65
41 0.65
42 0.71
43 0.71
44 0.65
45 0.66
46 0.57
47 0.46
48 0.38
49 0.28
50 0.18
51 0.12
52 0.11
53 0.08
54 0.08
55 0.11
56 0.13
57 0.14
58 0.17
59 0.18
60 0.21
61 0.29
62 0.31
63 0.3
64 0.33
65 0.42
66 0.45
67 0.45
68 0.43
69 0.37
70 0.34
71 0.34
72 0.3
73 0.3
74 0.24
75 0.31
76 0.38
77 0.45
78 0.48
79 0.53
80 0.53
81 0.44
82 0.47
83 0.41
84 0.37
85 0.31
86 0.3
87 0.23
88 0.24
89 0.23
90 0.2
91 0.2
92 0.2
93 0.2
94 0.29
95 0.39
96 0.44
97 0.55
98 0.64
99 0.72
100 0.77